Align Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19) (characterized)
to candidate PfGW456L13_2414 Omega-amino acid--pyruvate aminotransferase (EC 2.6.1.18)
Query= reanno::SB2B:6938540 (460 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2414 Length = 472 Score = 331 bits (849), Expect = 3e-95 Identities = 180/436 (41%), Positives = 258/436 (59%), Gaps = 5/436 (1%) Query: 10 SALQAMDAAHHLHPFTDSADLAKRGTRVIERAEGVYIWDAKGNKLLDAMAGLWCVNVGYG 69 S L D AHH+H + + A++G+ I +G YI+D +GN+ LDA+ G+WC N+G G Sbjct: 15 SRLVKADKAHHMHGYHVFDEHAEQGSLNIVAGDGAYIYDTQGNRFLDAVGGMWCTNIGLG 74 Query: 70 RKSIADAAYAQLQTLPFYNNFFQCTHEPAIRLASKIASLAPGHMNRVFFTGSGSEANDTN 129 R+ +A+A Q++ L + N F ++ AI L K+ASLAPG ++ VF T GS A DT Sbjct: 75 REEMAEAIADQVRQLAYSNPFSDMSNNVAIELCEKLASLAPGDLDHVFLTTGGSTAVDTA 134 Query: 130 LRMVRRYWDLKGMPSKKTIISRKNAYHGSTVAGASLGGMGFMH-QQGDLPIPGIVHIDQP 188 R+++ Y + +G P KK II+R NAYHGST S+G + D P I H+ P Sbjct: 135 YRLIQYYQNCRGKPEKKHIIARFNAYHGSTTLTMSIGNKAADRVPEFDYTNPLIHHVSNP 194 Query: 189 YWFGEGRDMSPEAFGIKTAQALEAKILELGEDKVAAFIAEPFQGAGGVIIPPDSYWNEIK 248 + M F + E KIL +G DKVA F AEP G+GGVIIPP Y + Sbjct: 195 NPYRAPDGMDEAQFLEFLVKEFEDKILSIGADKVAGFFAEPIMGSGGVIIPPRGYLKRMW 254 Query: 249 RILEKYNILFILDEVISGFGRTGNWFAA-QTLGLKPDLITIAKGMTSGYIPMGGVIVSDR 307 + ++Y+ILF+ DEV++ FGR G +FA+ + ++PD+IT AKG+TS Y+P+G I S+R Sbjct: 255 DVCQRYDILFVADEVVTSFGRLGKFFASYEVFDVQPDIITTAKGLTSAYLPLGACIFSER 314 Query: 308 VADVLISDGGE--FAHGFTYSGHPVAAAVALENIRILEEERLVDKVRTDTGPYLQDRLQT 365 + V+ G F HGFTYSGHPV AL+NI I+E E L+ V T G YL++RL T Sbjct: 315 IWKVIAEPGKGRCFTHGFTYSGHPVCCTAALKNIEIIERENLLAHVDT-VGAYLEERLAT 373 Query: 366 LSAHPLVGEVRGMGMVGAIELVADKHSMVRFGSEISAGMLCREACIESGLVMRAVGDTMI 425 L PLVG+VR ++ +E VADK + F EI+ G GL++R + + Sbjct: 374 LRDLPLVGDVRCQKLMACVEFVADKRTKALFPDEINIGEKIHVRAQARGLLVRPIMHLNV 433 Query: 426 ISPPLCITRDEIDELI 441 +SPPL +T ++DE++ Sbjct: 434 MSPPLILTSVQVDEIV 449 Lambda K H 0.321 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 573 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 460 Length of database: 472 Length adjustment: 33 Effective length of query: 427 Effective length of database: 439 Effective search space: 187453 Effective search space used: 187453 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory