GapMind for catabolism of small carbon sources

 

Aligments for a candidate for potA in Pseudomonas fluorescens GW456-L13

Align PotG aka B0855, component of Putrescine porter (characterized)
to candidate PfGW456L13_1569 Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)

Query= TCDB::P31134
         (377 letters)



>lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1569 Putrescine
           transport ATP-binding protein PotA (TC 3.A.1.11.1)
          Length = 372

 Score =  284 bits (727), Expect = 2e-81
 Identities = 165/367 (44%), Positives = 221/367 (60%), Gaps = 13/367 (3%)

Query: 17  TPLLEIRNLTKSYD----GQHAVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEQPS 72
           T  + IR++ K Y     G  A+  + L I   E F LLG SGCGK+TLLRM+AGFE P+
Sbjct: 9   TLAVSIRSVRKVYGDPKTGPVALKSIDLDIRDNEFFTLLGPSGCGKTTLLRMIAGFEFPT 68

Query: 73  AGQIMLDGVDLSQVPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDK----LPKAEIAS 128
            G+I+L G +++  PP+ RP+N +FQ YALFPHMT+ +N+AFGL+       L K ++A 
Sbjct: 69  EGEILLYGENIADRPPFQRPVNTVFQHYALFPHMTIAENLAFGLESHPMGKVLHKTQLAE 128

Query: 129 RVNEMLGLVHMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRM 188
           RV EML LV M+ FA RKP QLSGGQ+QRVALAR+LA  PK+LLLDEP+ ALD KLR  M
Sbjct: 129 RVREMLALVQMERFANRKPAQLSGGQQQRVALARALAPHPKVLLLDEPLSALDLKLRQAM 188

Query: 189 QLEVVDILERVGVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEHPTTRYSAE 248
           + E+  I  R G+T + VTHDQEEA+TM+ RIA+++ G+  Q+G PE+IYE P  R+ A+
Sbjct: 189 REELKTIQARTGITFIFVTHDQEEALTMSDRIAVLSEGEVQQVGRPEDIYERPRNRFVAD 248

Query: 249 FIGSVNVFEGVLKERQEDGLVLDSPGLVHPLKVDADASVVDNVPVHVALRPEKIMLCEEP 308
           FIG  N  EG +  R EDGL   +    HPL     + V     V +++RPE++ L    
Sbjct: 249 FIGETNFIEGTV-TRVEDGLAWFAGPAGHPLPAQPCSDVRVGANVTLSVRPERLHLV--- 304

Query: 309 PANGCNFAVGEVIHIAYLGDLSVYHVRLKSGQMISAQLQNAHRHRKGLPTWGDEVRLCWE 368
           PA   N     +    YLG    Y V L  G  ++ +  N     K     G +  L ++
Sbjct: 305 PATTENALPCRIEAQIYLGTDLQYQVSLSDGSRLTVRTPNCVDQSKRFAV-GSQAGLLFD 363

Query: 369 VDSCVVL 375
             S  VL
Sbjct: 364 QGSASVL 370


Lambda     K      H
   0.321    0.137    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 354
Number of extensions: 16
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 377
Length of database: 372
Length adjustment: 30
Effective length of query: 347
Effective length of database: 342
Effective search space:   118674
Effective search space used:   118674
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory