Align spermidine/putrescine ABC transporter, permease protein PotB (characterized)
to candidate PfGW456L13_3602 Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)
Query= CharProtDB::CH_088337 (275 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3602 Length = 305 Score = 191 bits (485), Expect = 2e-53 Identities = 114/261 (43%), Positives = 158/261 (60%), Gaps = 5/261 (1%) Query: 1 MIVTIVGWLVLFVFLPNLMIIGTSFLTRDDASFVKMVFTLDNYTRLLDPLYFEVLLHSLN 60 M++ W +L + +P ++I+ SF R FTL NY L ++L Sbjct: 34 MLLPSTLWFLLLLLMPLVIILVFSFGERSAVGGYAGGFTLANYLNLGSR--GAAFSNTLM 91 Query: 61 MALIATLACLVLGYPFAWFLAKLPHKVRPLLLFLLIVPFWTNSLIRIYGLKIFLSTKGYL 120 +A + TL CLV YP A+FLA + R LLL L+IVPFWT+ LIR Y LS KG + Sbjct: 92 LAPLGTLVCLVAAYPLAYFLAVKVTRNRSLLLTLVIVPFWTSFLIRTYAWIFILSGKG-I 150 Query: 121 NEFLLWLGVIDTPIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLDKPLLEAARDLGAS 180 L LG+ D +R++ TP AV+IG+VY LP MV P+Y S+EKLDK LLEA+ DLGAS Sbjct: 151 PALLASLGLED--VRLINTPWAVLIGIVYGYLPLMVFPIYVSLEKLDKRLLEASADLGAS 208 Query: 181 KLQTFIRIIIPLTMPGIIAGCLLVMLPAMGLFYVSDLMGGAKNLLIGNVIKVQFLNIRDW 240 ++F RI +PL+ PGII G +LV + MG F + ++GG K +GN + FL R+W Sbjct: 209 AFESFRRITLPLSAPGIITGVMLVFILLMGEFLIPAILGGGKVFFVGNALVDLFLQSRNW 268 Query: 241 PFGAATSITLTIVMGLMLLVY 261 PFG+A ++TL +M L++ VY Sbjct: 269 PFGSALAMTLVAMMLLIIGVY 289 Lambda K H 0.333 0.148 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 303 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 305 Length adjustment: 26 Effective length of query: 249 Effective length of database: 279 Effective search space: 69471 Effective search space used: 69471 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory