Align Putrescine-binding periplasmic protein SpuD (characterized)
to candidate PfGW456L13_3073 Putrescine ABC transporter, periplasmic putrescine-binding protein
Query= SwissProt::Q02UB7 (367 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3073 Length = 361 Score = 436 bits (1121), Expect = e-127 Identities = 202/349 (57%), Positives = 264/349 (75%), Gaps = 2/349 (0%) Query: 18 VAGMAQAADNKVLHVYNWSDYIAPDTLEKFTKETGIKVVYDVYDSNEVLEAKLLAGKSGY 77 VA ++QAA+ + +YNWSDYIAPDT + F KETGI YDVYDSNE L+ KL+ GKSGY Sbjct: 14 VASISQAAET--VKIYNWSDYIAPDTTKNFQKETGIGFTYDVYDSNETLDGKLMTGKSGY 71 Query: 78 DVVVPSNSFLAKQIKAGVYQKLDKSKLPNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTIG 137 DVV PSN F+A+QI+ G +KLDKS+LPNWKNLN L+ L+ +DPGNEH PY+WG+ G Sbjct: 72 DVVFPSNHFMARQIEGGALKKLDKSQLPNWKNLNPVLLKALQTNDPGNEHGFPYLWGSTG 131 Query: 138 IGYNPDKVKAAFGDNAPVDSWDLVFKPENIQKLKQCGVSFLDSPTEILPAALHYLGYKPD 197 IGYN KVKA GDNAPVDSWDL+FKPEN+QKL +CGV+ LD+ E+LPAAL+YLG Sbjct: 132 IGYNIAKVKAVLGDNAPVDSWDLIFKPENMQKLHKCGVAILDNGPELLPAALNYLGLPHH 191 Query: 198 TDNPKELKAAEELFLKIRPYVTYFHSSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKN 257 + NP++ K AE L +K+RPYV+YFHSSKY SDLANG+ICVA+G+SGDI QA++RA EA N Sbjct: 192 SKNPEDYKKAEALLMKVRPYVSYFHSSKYTSDLANGDICVAVGFSGDILQAENRAREANN 251 Query: 258 KVTVKYNIPKEGAGSFFDMVAIPKDAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAA 317 + + Y+IPKEGA +FDMVA+P DA + + AF+++L++P++MA +++ V + NGN Sbjct: 252 GIDIGYSIPKEGAAIWFDMVAMPADAPDDKAGYAFMDYLLRPDVMASVSNYVHYANGNEQ 311 Query: 318 ATPLVSEAIRNDPGIYPSEEVMKKLYTFPDLPAKTQRAMTRSWTKIKSG 366 A L+ AI+ND +YPS E+M KL+ +P R TR W KI++G Sbjct: 312 ADSLIDPAIKNDTKVYPSPEMMGKLFALEAMPLNIDRVRTRVWNKIRTG 360 Lambda K H 0.315 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 493 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 361 Length adjustment: 29 Effective length of query: 338 Effective length of database: 332 Effective search space: 112216 Effective search space used: 112216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory