Align Putrescine-binding periplasmic protein SpuD (characterized)
to candidate PfGW456L13_929 Putrescine ABC transporter putrescine-binding protein PotF (TC 3.A.1.11.2)
Query= SwissProt::Q02UB7 (367 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_929 Length = 360 Score = 429 bits (1104), Expect = e-125 Identities = 205/351 (58%), Positives = 268/351 (76%), Gaps = 3/351 (0%) Query: 17 SVAGMAQAADNKVLHVYNWSDYIAPDTLEKFTKETGIKVVYDVYDSNEVLEAKLLAGKSG 76 +VA QAA +H+YNWSDYI TL F KETGIK VYDV+DSNE LE KLLAG++G Sbjct: 13 TVAVSVQAAGT--VHIYNWSDYIGETTLADFQKETGIKPVYDVFDSNETLEGKLLAGRTG 70 Query: 77 YDVVVPSNSFLAKQIKAGVYQKLDKSKLPNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTI 136 YDVVVPSN FL KQIKAG +QKLDKS+LPN+ NL+ L+ LE +DPGN +A+PY+WGT Sbjct: 71 YDVVVPSNHFLGKQIKAGAFQKLDKSQLPNYSNLDPVLLKRLEQNDPGNLYAVPYLWGTN 130 Query: 137 GIGYNPDKVKAAFGDNAPVDSWDLVFKPENIQKLKQCGVSFLDSPTEILPAALHYLGYKP 196 GIGYN DKVKA G + +DSW ++F+P+NI+KL+ CGV+FLDS E++P L+Y+G Sbjct: 131 GIGYNVDKVKAVLGVDT-IDSWGVLFEPQNIKKLQSCGVAFLDSADEMMPTVLNYMGLNA 189 Query: 197 DTDNPKELKAAEELFLKIRPYVTYFHSSKYISDLANGNICVAIGYSGDIYQAKSRAEEAK 256 ++ +PK+ + A L +RPYVTYFHSSKYI+DLANG+ICVAIG+SGDI+QAK+RAEEAK Sbjct: 190 NSTDPKDYEKATAKLLAVRPYVTYFHSSKYIADLANGDICVAIGFSGDIFQAKNRAEEAK 249 Query: 257 NKVTVKYNIPKEGAGSFFDMVAIPKDAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNA 316 V + Y+IPKEG +FDM+AIPKD+ N + A AF+N+L+KPE++A+++D V + N N Sbjct: 250 KGVNIAYSIPKEGGALWFDMLAIPKDSANVKQAHAFINYLLKPEVIAQVSDYVGYANPNP 309 Query: 317 AATPLVSEAIRNDPGIYPSEEVMKKLYTFPDLPAKTQRAMTRSWTKIKSGK 367 + L+ ++IR D +YP +EV+ K Y +LP QR MTRSWTK+KSGK Sbjct: 310 GSDKLMEQSIRTDEAVYPPQEVLDKTYVSVELPPNIQRLMTRSWTKVKSGK 360 Lambda K H 0.315 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 476 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 360 Length adjustment: 29 Effective length of query: 338 Effective length of database: 331 Effective search space: 111878 Effective search space used: 111878 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory