GapMind for catabolism of small carbon sources

 

Aligments for a candidate for puo in Pseudomonas fluorescens GW456-L13

Align Primary amine oxidase 1; AtAO1; EC 1.4.3.21 (characterized)
to candidate PfGW456L13_2439 Monoamine oxidase (1.4.3.4)

Query= SwissProt::O23349
         (650 letters)



>lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2439 Monoamine
           oxidase (1.4.3.4)
          Length = 762

 Score =  288 bits (738), Expect = 5e-82
 Identities = 202/648 (31%), Positives = 303/648 (46%), Gaps = 42/648 (6%)

Query: 23  HPLDPLTPQEINKTSFIVKKSHLGNLKD-LTFHYLDLEEPNKSHVLQWLSPNPSKKPPPP 81
           +PL+PL+  EI     IVKKS   N K    F  + ++EP K  V  +     +   P  
Sbjct: 130 NPLNPLSAAEITTAVDIVKKSE--NYKPGFRFTEVSVKEPPKDQVWNFALTGQNVAQP-- 185

Query: 82  RRRSFVVVRAGGQTYELIIDLTTSKIASSRIYTG-HGFPSFTFIELFKASKLPL-TYPPF 139
            R++ +VV  G    E  +DL T ++ S +   G HG      ++ F   +  + T P +
Sbjct: 186 -RQASIVVLDGKHVIEAQVDLDTKELKSWKPIEGAHGM---VLLDDFATVQTAVETSPEY 241

Query: 140 KKSILDRSLN-ISEVSCIPFTVGWY----GETTTRRELKASCFYRDGSVNVFTRPIEGIT 194
            +++  R +N + +V   P TVG++    G    +R LK   +   G  N +  PIEG+ 
Sbjct: 242 AQALAKRGINDVKKVVATPLTVGFFDGKDGLAQDKRLLKIVSYLNTGDGNYWAHPIEGLV 301

Query: 195 VTIDVDSMQVIKYSDRFRKPIP-DKEGNDFRTKH----RPFPFFCNVSDTGFKILGNRVK 249
             +D++  ++IK  D    P+P +    D R +     +P           + I GN + 
Sbjct: 302 AIVDLEQKKLIKIEDDALIPVPMNPTPYDGRGRQGVAVKPLEII-EPEGKNYTISGNSIH 360

Query: 250 WANWKFHVGFTARAGVTISTASVLDPRTKRFRRVMYRGHVSETFVPYMDPTYEWYYRTFM 309
           W NW FHV   +R G  +ST +  D   KR  ++MY G +    VPY DP   WY++ ++
Sbjct: 361 WQNWDFHVRLDSRVGPILSTVTYDDKGKKR--KIMYEGSLGGMIVPYGDPDVGWYFKAYL 418

Query: 310 DIGEFGFGRSAVNLQPLIDCPQNAAFLDGHVAGPDGTAQKMTNVMCVFEKNGYGASFRHT 369
           D G++G G     +    D PQNA  LD  +A   GT   +   M VFE+   G  ++H 
Sbjct: 419 DSGDYGMGTLTSPIARGKDAPQNAVLLDATIADYTGTPTAIPRAMAVFERYA-GPEYKHQ 477

Query: 370 EINVPGQVITSGEAEISLVVRMVATLGNYDYIVDWEFKKNGAIRVGVDLTGVLEVKATSY 429
           E+  P       E    LVVR ++T+GNYDYI DW F++NG I +    TG+  VK    
Sbjct: 478 EMGQPNLSTERRE----LVVRWISTVGNYDYIFDWVFQQNGTIGIDAGATGIEAVKGVKS 533

Query: 430 TSNDQIT---ENVYGTLVAKNTIAVNHDHYLTYYLDLDVDGNGNSLVKAKLKTVRVTEVN 486
            +  + T   +  YGTL+  N +   H H   + LD+DVDG  NSLV+       V   N
Sbjct: 534 KTMHEDTAREDTRYGTLLDHNIVGTTHQHIYNFRLDMDVDGEQNSLVEVN----PVVLPN 589

Query: 487 KTSSRRKSYWTVVKETAKTEADGRVRLGSDPVELLIVNPNKKTKIGNTVGYRLIP----- 541
                R S      +    E     +     V LL  N +K+ K+GN V Y+LIP     
Sbjct: 590 DRGGPRTSTMQTETKVVGNEQQAAQKFDPSTVRLL-TNFSKENKVGNPVSYQLIPYAGGT 648

Query: 542 EHLQATSLLTDDDYPELRAGYTKYPVWVTAYDRSERWAGGFYSDRSRGDDGLAVWSSRNR 601
             +   +    D++   R  +    +WVT Y+  E++  G Y +RS  D GL  ++  N 
Sbjct: 649 HPVAKGANFGKDEWLYHRLSFMDKQLWVTQYNPEEKYPEGKYPNRSDKDSGLGQFTQDNH 708

Query: 602 EIENKDIVMWYNVGFHHIPYQEDFPVMPTLHGGFTLRPSNFFDNDPLI 649
            IEN D V+W   G  HI   E++P+MPT      L+P NFFD  P +
Sbjct: 709 SIENTDDVVWLTTGTTHIARAEEWPIMPTEWVHVLLKPWNFFDETPTL 756


Lambda     K      H
   0.320    0.138    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1273
Number of extensions: 69
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 650
Length of database: 762
Length adjustment: 39
Effective length of query: 611
Effective length of database: 723
Effective search space:   441753
Effective search space used:   441753
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory