Align required for pyruvate transport, with AZOBR_RS02940 (characterized)
to candidate PfGW456L13_2422 Putative membrane protein, clustering with ActP PaaL
Query= reanno::azobra:AZOBR_RS02935 (100 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2422 Length = 102 Score = 90.1 bits (222), Expect = 6e-24 Identities = 44/96 (45%), Positives = 63/96 (65%) Query: 3 ENAQRILANPKFQELVQKRSAFAWTLSIAMLVIYFGFILLVAFGKGFLGTPIGSGVTTWG 62 + + I +P F +LV+++ W+LS+AMLVIY+GF+LLVAF LG + GVTT G Sbjct: 4 QEIELIRQHPDFIQLVRRKQKLYWSLSLAMLVIYYGFVLLVAFSPSTLGQSLSGGVTTVG 63 Query: 63 IPVGLFTIISAFILTGIYVHRANGEFDELNRQIMEE 98 + VG+ + AF LTG YV+RAN D LN ++ +E Sbjct: 64 MLVGVVIVGLAFALTGFYVYRANNVIDPLNEKLKQE 99 Lambda K H 0.326 0.142 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 42 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 100 Length of database: 102 Length adjustment: 11 Effective length of query: 89 Effective length of database: 91 Effective search space: 8099 Effective search space used: 8099 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.2 bits) S2: 39 (19.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory