GapMind for catabolism of small carbon sources

 

Aligments for a candidate for rhaT' in Pseudomonas fluorescens GW456-L13

Align RhaT, component of Rhamnose porter (Richardson et al., 2004) (Transport activity is dependent on rhamnokinase (RhaK; AAQ92412) activity (Richardson and Oresnik, 2007) This could be an example of group translocation!) (characterized)
to candidate PfGW456L13_3911 Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)

Query= TCDB::Q7BSH4
         (512 letters)



>lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3911 Ribose ABC
           transport system, ATP-binding protein RbsA (TC
           3.A.1.2.1)
          Length = 517

 Score =  283 bits (723), Expect = 1e-80
 Identities = 178/499 (35%), Positives = 277/499 (55%), Gaps = 18/499 (3%)

Query: 19  AILEMRGISQIFPGVKALDNVSIALHPGTVTALIGENGAGKSTLVKILTGIYRPNEGEIL 78
           A+L + GI + +     L  + + L  G V AL GENGAGKSTL KI+ G+  P  G++ 
Sbjct: 8   AVLSVSGIGKTY-AQPVLAGIDLTLMRGEVLALTGENGAGKSTLSKIIGGLVTPTTGQMQ 66

Query: 79  VDG---RPTTFASAQAAIDAGVTAIHQETVLFDELTVAENIFLGHAPRTRFRTIDWQTMN 135
             G   RP + A A+A    G+  + QE  L   L+VAEN+FL + P        W +  
Sbjct: 67  YQGQDYRPGSRAQAEAL---GIRMVMQELNLLPTLSVAENLFLDNLPSKG----GWISRK 119

Query: 136 SRSKALLTALE----SNIDPTIRLKDLSIAQRHLVAIARALSIEARIVIMDEPTAALSRK 191
              KA + A+       IDP   + +L I  + +V IAR L  +  ++I+DEPTA L+ +
Sbjct: 120 QLRKAAIEAMAHVGLDAIDPDTLVGELGIGHQQMVEIARNLIGDCHVLILDEPTAMLTAR 179

Query: 192 EIDDLFRIVRGLKEQGKAILFISHKFDELYEIADDFVVFPRRSRRPVRGVSRKTPQDEIV 251
           E++ LF  +  L+ +G +I++ISH+ +EL  +A    V    +   V  ++     +++V
Sbjct: 180 EVEMLFEQITRLQSRGVSIIYISHRLEELARVAQRIAVLRDGNLVCVEPMANYN-SEQLV 238

Query: 252 RMMVGRDVENVFPKIDVAIGGPVLEIRNYSHRTEFRDISFTLRKGEILGVYGLIGAGRSE 311
            +MVGR++          IG PVL +   S   + RD+SF +R GEI G+ GLIGAGR+E
Sbjct: 239 TLMVGRELGEHIDMGARKIGAPVLTVNGLSRSDKVRDVSFEVRAGEIFGISGLIGAGRTE 298

Query: 312 LSQSLFGITKPLSGKMVL--EGQEITIHSPQDAIRAGIVYVPEERGRHGLALPMPIFQNM 369
           L + +FG     SG + L    Q I + SP DA+  GI  + E+R   GL L   I  N+
Sbjct: 299 LLRLIFGADIADSGTIALGAPAQVINVRSPVDAVGHGIALITEDRKGEGLLLTQSIGANI 358

Query: 370 TLPSLARTSRRGFLRAANEFALARKYAERLDLRAAALSVPVGTLSGGNQQKVVIGKWLAT 429
            L ++   S  GF+    E ALA++  + + +R++  +  V  LSGGNQQKVVIG+WL  
Sbjct: 359 ALGNMPGISGAGFVDNDKERALAQRQIDAMRIRSSGPAQLVSELSGGNQQKVVIGRWLER 418

Query: 430 APKVIILDEPTKGIDIGSKAAVHGFISELAAEGLSIIMVSSELPEIIGMSDRVLVMKEGL 489
              V++ DEPT+GID+G+K  ++  + EL  +G ++++VSS+L E++ + DR+ V+  G 
Sbjct: 419 DCSVLLFDEPTRGIDVGAKFDIYNLLGELTRQGKALVVVSSDLRELMLICDRIGVLSAGS 478

Query: 490 SAGIFERAELSPEALVRAA 508
               F+R   + + L+ AA
Sbjct: 479 LIDTFDRDSWTQDELLAAA 497



 Score = 84.3 bits (207), Expect = 9e-21
 Identities = 67/222 (30%), Positives = 107/222 (48%), Gaps = 5/222 (2%)

Query: 289 ISFTLRKGEILGVYGLIGAGRSELSQSLFGITKPLSGKMVLEGQEITIHSPQDAIRAGIV 348
           I  TL +GE+L + G  GAG+S LS+ + G+  P +G+M  +GQ+    S   A   GI 
Sbjct: 27  IDLTLMRGEVLALTGENGAGKSTLSKIIGGLVTPTTGQMQYQGQDYRPGSRAQAEALGIR 86

Query: 349 YVPEERGRHGLALPMPIFQNMTLPSLARTSRRGFLRAANEFALARKYAERLDLRAAALSV 408
            V +E     L   + + +N+ L +L   S+ G++        A +    + L A     
Sbjct: 87  MVMQELN---LLPTLSVAENLFLDNLP--SKGGWISRKQLRKAAIEAMAHVGLDAIDPDT 141

Query: 409 PVGTLSGGNQQKVVIGKWLATAPKVIILDEPTKGIDIGSKAAVHGFISELAAEGLSIIMV 468
            VG L  G+QQ V I + L     V+ILDEPT  +       +   I+ L + G+SII +
Sbjct: 142 LVGELGIGHQQMVEIARNLIGDCHVLILDEPTAMLTAREVEMLFEQITRLQSRGVSIIYI 201

Query: 469 SSELPEIIGMSDRVLVMKEGLSAGIFERAELSPEALVRAATG 510
           S  L E+  ++ R+ V+++G    +   A  + E LV    G
Sbjct: 202 SHRLEELARVAQRIAVLRDGNLVCVEPMANYNSEQLVTLMVG 243


Lambda     K      H
   0.320    0.137    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 632
Number of extensions: 32
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 512
Length of database: 517
Length adjustment: 35
Effective length of query: 477
Effective length of database: 482
Effective search space:   229914
Effective search space used:   229914
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory