GapMind for catabolism of small carbon sources

 

Aligments for a candidate for rbsA in Pseudomonas fluorescens GW456-L13

Align ribose transport, ATP-binding protein RbsA; EC 3.6.3.17 (characterized)
to candidate PfGW456L13_2121 L-arabinose transport ATP-binding protein AraG (TC 3.A.1.2.2)

Query= CharProtDB::CH_003578
         (501 letters)



>lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2121 L-arabinose
           transport ATP-binding protein AraG (TC 3.A.1.2.2)
          Length = 514

 Score =  411 bits (1057), Expect = e-119
 Identities = 222/490 (45%), Positives = 323/490 (65%), Gaps = 3/490 (0%)

Query: 5   LQLKGIDKAFPGVKALSGAALNVYPGRVMALVGENGAGKSTMMKVLTGIYTRDAGTLLWL 64
           L+  GI K FPGVKAL   +   +PG+V AL+GENGAGKST++K+L G YT  +G L   
Sbjct: 16  LRFNGIGKTFPGVKALDNISFVAHPGQVHALMGENGAGKSTLLKILGGAYTPCSGALQIG 75

Query: 65  GKETTFTGPKSSQEAGIGIIHQELNLIPQLTIAENIFLGREFVNRFGKIDWKTMYAEADK 124
            +   F     S  +G+ +IHQEL+L+P++T+AEN+FLG      FG I+  T+  +A  
Sbjct: 76  ERTMDFKSTADSIGSGVAVIHQELHLVPEMTVAENLFLGH-LPASFGLINRSTLRQQALA 134

Query: 125 LLAKLNLRFKSDKLVGDLSIGDQQMVEIAKVLSFESKVIIMDEPTDALTDTETESLFRVI 184
            L  L       + VG LS+G +Q+VEIAK LS  + VI  DEPT +L+  E + L  +I
Sbjct: 135 CLKGLADEIDPQEKVGRLSLGQRQLVEIAKALSRGAHVIAFDEPTSSLSAREIDRLMAII 194

Query: 185 RELKSQGRGIVYISHRMKEIFEICDDVTVFRDGQFIAE-REVASLTEDSLIEMMVGRKLE 243
             L+ +G+ ++Y+SHRM+E+F IC+ VTVF+DG+++    +++ LT D L+  MVGR ++
Sbjct: 195 GRLRDEGKVVLYVSHRMEEVFRICNAVTVFKDGRYVRTFDDMSQLTHDQLVTCMVGRDIQ 254

Query: 244 DQYPHLDKAPGDIRLKVDNLCGPGVND-VSFTLRKGEILGVSGLMGAGRTELMKVLYGAL 302
           D Y +  +  G + LKVD L GPG+ + VSF + KGEILG+ GL+GAGRTEL+++L G  
Sbjct: 255 DIYDYRPRQRGAVALKVDGLLGPGLREPVSFEVHKGEILGLFGLVGAGRTELLRLLSGLA 314

Query: 303 PRTSGYVTLDGHEVVTRSPQDGLANGIVYISEDRKRDGLVLGMSVKENMSLTALRYFSRA 362
             ++G + L GHE+  RSP+D +A GI+   EDRK++G++   SV EN++++A    S  
Sbjct: 315 RHSAGQLKLRGHELKLRSPRDAIAAGILLCPEDRKKEGILPLASVAENINISARGAHSTF 374

Query: 363 GGSLKHADEQQAVSDFIRLFNVKTPSMEQAIGLLSGGNQQKVAIARGLMTRPKVLILDEP 422
           G  L+   E+      I+   VKTP+  Q I  LSGGNQQK  + R L    KVL+LDEP
Sbjct: 375 GCLLRGLWEKDNAEQQIKALKVKTPNAAQKIMYLSGGNQQKAILGRWLSMPMKVLLLDEP 434

Query: 423 TRGVDVGAKKEIYQLINQFKADGLSIILVSSEMPEVLGMSDRIIVMHEGHLSGEFTREQA 482
           TRG+D+GAK EIYQ+I+   A+G+++I+VSS++ EV+G+SDRI+V+ EG L GE +REQA
Sbjct: 435 TRGIDIGAKAEIYQIIHNLAAEGIAVIVVSSDLMEVMGISDRILVLCEGALRGELSREQA 494

Query: 483 TQEVLMAAAV 492
            +  L+  A+
Sbjct: 495 NESNLLQLAL 504



 Score = 84.7 bits (208), Expect = 7e-21
 Identities = 60/237 (25%), Positives = 117/237 (49%), Gaps = 10/237 (4%)

Query: 15  PGVKALSGAALNVYPGRVMALVGENGAGKSTMMKVLTGIYTRDAGTLLWLGKETTFTGPK 74
           PG++     +  V+ G ++ L G  GAG++ ++++L+G+    AG L   G E     P+
Sbjct: 277 PGLR--EPVSFEVHKGEILGLFGLVGAGRTELLRLLSGLARHSAGQLKLRGHELKLRSPR 334

Query: 75  SSQEAGIGIIHQELN---LIPQLTIAENIFLG-REFVNRFGKID---WKTMYAEADKLLA 127
            +  AGI +  ++     ++P  ++AENI +  R   + FG +    W+   AE      
Sbjct: 335 DAIAAGILLCPEDRKKEGILPLASVAENINISARGAHSTFGCLLRGLWEKDNAEQQIKAL 394

Query: 128 KLNLRFKSDKLVGDLSIGDQQMVEIAKVLSFESKVIIMDEPTDALTDTETESLFRVIREL 187
           K+     + K++  LS G+QQ   + + LS   KV+++DEPT  +       ++++I  L
Sbjct: 395 KVKTPNAAQKIMY-LSGGNQQKAILGRWLSMPMKVLLLDEPTRGIDIGAKAEIYQIIHNL 453

Query: 188 KSQGRGIVYISHRMKEIFEICDDVTVFRDGQFIAEREVASLTEDSLIEMMVGRKLED 244
            ++G  ++ +S  + E+  I D + V  +G    E       E +L+++ + R+  D
Sbjct: 454 AAEGIAVIVVSSDLMEVMGISDRILVLCEGALRGELSREQANESNLLQLALPRQRAD 510


Lambda     K      H
   0.318    0.137    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 671
Number of extensions: 31
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 501
Length of database: 514
Length adjustment: 34
Effective length of query: 467
Effective length of database: 480
Effective search space:   224160
Effective search space used:   224160
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory