Align L-serine dehydratase, alpha chain; Short=SDH; EC 4.3.1.17 (characterized, see rationale)
to candidate PfGW456L13_1867 L-serine dehydratase (EC 4.3.1.17)
Query= uniprot:P33073 (292 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1867 Length = 458 Score = 127 bits (318), Expect = 6e-34 Identities = 78/183 (42%), Positives = 109/183 (59%), Gaps = 6/183 (3%) Query: 97 AFSTSEVNASMGKIVAAPTAGSSGIMPAML---VAATEKYNFDRTTIQNGFLTSIGIGQV 153 A + +E NA+ G++V APT G++GI+PA+L + N D + LT+ IG + Sbjct: 272 ALAVNEENANGGRVVTAPTNGAAGIIPAVLHYYMRFIPGSNDDG--VVRFLLTAAAIGIL 329 Query: 154 ITKYATFAGAEGGCQAECGSASAMAAAALVEMLGGTVEQALHAASITIINVLGLVCDPIA 213 + A+ +GAE GCQ E G A +MAA AL E+LGG+V+Q +AA I + + LGL CDPI Sbjct: 330 YKENASISGAEVGCQGEVGVACSMAAGALCEVLGGSVQQVENAAEIGMEHNLGLTCDPIG 389 Query: 214 GLVQYPCTFRNASGVINAFISADLALAG-VESLVPFDEVVIAMGEVGNSMIEALRETGLG 272 GLVQ PC RNA G + A + +AL G + V D+V+ M + G M +ET G Sbjct: 390 GLVQVPCIERNAMGSVKAINAVRMALRGDGQHFVSLDKVIRTMRQTGADMKSKYKETARG 449 Query: 273 GLA 275 GLA Sbjct: 450 GLA 452 Lambda K H 0.317 0.132 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 458 Length adjustment: 30 Effective length of query: 262 Effective length of database: 428 Effective search space: 112136 Effective search space used: 112136 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory