Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate PfGW456L13_2058 Short-chain dehydrogenase/reductase SDR
Query= BRENDA::Q1J2J0 (255 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2058 Length = 253 Score = 149 bits (375), Expect = 7e-41 Identities = 100/249 (40%), Positives = 140/249 (56%), Gaps = 13/249 (5%) Query: 18 GRHALVTGGAQGIGFEIARGLAQAGARVTIADLNPDVGEGAAREL-----DGTFERLNVT 72 G+ +VTGGA GIG A+ A G +V +AD++ GEG + + TF R NVT Sbjct: 7 GQVVVVTGGAAGIGRATAQAFAAEGLKVVVADMDVAGGEGTVALIRTAGGEATFVRCNVT 66 Query: 73 DADAVADLARRLPD----VDVLVNNAGI-VRNAPAEDTPDDDWRAVLSVNLDGVFWCCRE 127 V +L + + +D NNAGI + + D++ A++ VN+ GV+ C + Sbjct: 67 LESDVKNLMEEVINTYGRLDYAFNNAGIEIEKGKLAEGTLDEFDAIMGVNVKGVWLCMKY 126 Query: 128 FGRTMLARGRGAIVSTASMSGLISNHPQPQAAYNASKAAVIHLTRSLAGEWASRGVRVNA 187 +LA+G GAIV+TAS++GL + Y ASK AVI LT+S A E+A + +RVNA Sbjct: 127 QLPLLLAQGGGAIVNTASVAGL--GAAPKMSIYAASKHAVIGLTKSAAIEYAKKKIRVNA 184 Query: 188 VAPGYTATPLTRRGLET-PEWRETWLKETPLGRLAEPREIAPAVLYLASDAASFVTGHTL 246 V P T + RR E P+ E P+GR+ + EIA AVLYL SD A+F TGH+L Sbjct: 185 VCPAVIDTDMFRRAYEADPKKGEFANAMHPVGRIGKVEEIASAVLYLCSDGAAFTTGHSL 244 Query: 247 VVDGGYTVW 255 VDGG T + Sbjct: 245 AVDGGVTAF 253 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 253 Length adjustment: 24 Effective length of query: 231 Effective length of database: 229 Effective search space: 52899 Effective search space used: 52899 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory