Align acetaldehyde dehydrogenase (acetylating) (EC 1.2.1.10); propanal dehydrogenase (CoA-propanoylating) (EC 1.2.1.87) (characterized)
to candidate PfGW456L13_2505 Acetaldehyde dehydrogenase, acetylating, (EC 1.2.1.10) in gene cluster for degradation of phenols, cresols, catechol
Query= BRENDA::Q79AF6 (304 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2505 Length = 302 Score = 465 bits (1197), Expect = e-136 Identities = 223/299 (74%), Positives = 262/299 (87%) Query: 1 MTKKIKCALIGPGNIGTDLLAKLQRSPVLEPIWMVGIDPESDGLKRAREMGIKTTADGVD 60 M+KK++ A+IGPGNIGTDLL K+ RS +EP+WMVG+DP+S+GLKRAREMGIKTTA GVD Sbjct: 1 MSKKLRAAIIGPGNIGTDLLMKMCRSQWIEPVWMVGVDPDSEGLKRAREMGIKTTAGGVD 60 Query: 61 GLIPHMQADGVQIVFDATSAYVHADNSRKVNALGALMIDLTPAAIGPFCVPTVNLKEHVG 120 GL+PH+ D ++I FDATSAYVHA+NSRK+N LG +MIDLTPAAIGP+CVP VNLKEH Sbjct: 61 GLLPHVLDDDIRIAFDATSAYVHAENSRKLNELGVIMIDLTPAAIGPYCVPPVNLKEHAS 120 Query: 121 KGEMNVNMVTCGGQATIPMVAAVSRVQPVAYGEIVATVSSKSAGPGTRKNIDEFTRTTAG 180 MNVNMVTCGGQATIPMVAAVSRVQPV+YGEIVATVSS S GPGTR+NIDEFTRTTAG Sbjct: 121 SLAMNVNMVTCGGQATIPMVAAVSRVQPVSYGEIVATVSSGSVGPGTRQNIDEFTRTTAG 180 Query: 181 AVEKVGGAKKGKAIIILNPAEPPLIMRDTVHCLLESEPDQAKITESIHAMIKEVQKYVPG 240 AVEK+GGA++GKAII++NPAEPPL+MRDT+HCL + EP+Q I S+ M++EVQ+YVPG Sbjct: 181 AVEKIGGARRGKAIIVINPAEPPLMMRDTIHCLTDDEPNQDAIRTSVLEMVREVQRYVPG 240 Query: 241 YKLVNGPVFDGLRVSVYLEVEGLGDYLPKYAGNLDIMTAAAARTAEMFAEEILAGQLTL 299 YKL+NGPVFDG +VS+++EVEGLGD+LPK AGNLDIMTAA RTAEMFAEE G L L Sbjct: 241 YKLINGPVFDGRKVSIFIEVEGLGDFLPKSAGNLDIMTAAGLRTAEMFAEEAHKGTLQL 299 Lambda K H 0.317 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 304 Length of database: 302 Length adjustment: 27 Effective length of query: 277 Effective length of database: 275 Effective search space: 76175 Effective search space used: 76175 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate PfGW456L13_2505 (Acetaldehyde dehydrogenase, acetylating, (EC 1.2.1.10) in gene cluster for degradation of phenols, cresols, catechol)
to HMM TIGR03215 (acetaldehyde dehydrogenase (acetylating) (EC 1.2.1.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03215.hmm # target sequence database: /tmp/gapView.6144.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03215 [M=285] Accession: TIGR03215 Description: ac_ald_DH_ac: acetaldehyde dehydrogenase (acetylating) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-143 463.2 0.2 1.8e-143 463.0 0.2 1.0 1 lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2505 Acetaldehyde dehydrogenase, acet Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2505 Acetaldehyde dehydrogenase, acetylating, (EC 1.2.1.10) in gen # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 463.0 0.2 1.8e-143 1.8e-143 1 283 [. 4 292 .. 4 294 .. 0.98 Alignments for each domain: == domain 1 score: 463.0 bits; conditional E-value: 1.8e-143 TIGR03215 1 kvkvaiiGsGnigtdllikllrsevlelallvGidpesdGlararelgvetsaeG 55 k+++aiiG+Gnigtdll+k+ rs+ +e++++vG+dp+s+Gl+rare+g++t+a G lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2505 4 KLRAAIIGPGNIGTDLLMKMCRSQWIEPVWMVGVDPDSEGLKRAREMGIKTTAGG 58 789**************************************************** PP TIGR03215 56 vdalleee...didivfdatsakahaenaklleelgkividltPaavGpyvvPav 107 vd+ll + di+i+fdatsa++haen+++l+elg+i+idltPaa+Gpy+vP+v lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2505 59 VDGLLPHVlddDIRIAFDATSAYVHAENSRKLNELGVIMIDLTPAAIGPYCVPPV 113 ******98888******************************************** PP TIGR03215 108 nleevldak..nvnlvtCgGqatiPivaavsrvakvkyaeivasiasksaGpgtr 160 nl+e+ + nvn+vtCgGqatiP+vaavsrv++v+y+eiva+++s s+Gpgtr lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2505 114 NLKEHASSLamNVNMVTCGGQATIPMVAAVSRVQPVSYGEIVATVSSGSVGPGTR 168 *****987667******************************************** PP TIGR03215 161 anideftettskaleqvgGakkgkaiiilnPaePpllmrdtvyalv.eeadeeai 214 +nideft+tt+ a+e++gGa++gkaii++nPaePpl+mrdt+++l+ +e++++ai lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2505 169 QNIDEFTRTTAGAVEKIGGARRGKAIIVINPAEPPLMMRDTIHCLTdDEPNQDAI 223 **********************************************899****** PP TIGR03215 215 easveemveevqkyvpGyrlkqevvldgekvsvlleveGagdylPkyaGnldilt 269 ++sv emv+evq+yvpGy+l + +v+dg+kvs+++eveG gd+lPk aGnldi+t lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2505 224 RTSVLEMVREVQRYVPGYKLINGPVFDGRKVSIFIEVEGLGDFLPKSAGNLDIMT 278 ******************************************************* PP TIGR03215 270 aaalavaeklaeel 283 aa l++ae++aee lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2505 279 AAGLRTAEMFAEEA 292 ***********975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (285 nodes) Target sequences: 1 (302 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.34 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory