Align lactoylglutathione lyase (EC 4.4.1.5) (characterized)
to candidate PfGW456L13_2929 Lactoylglutathione lyase (EC 4.4.1.5)
Query= BRENDA::Q88GF8 (175 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2929 Length = 173 Score = 300 bits (767), Expect = 1e-86 Identities = 142/173 (82%), Positives = 151/173 (87%) Query: 1 MSLHDLQTLPGVTAQPDAATAQFVFNHTMLRVKDIEKSLDFYTRVLGFRLVDKRDFPEAA 60 MSLH+L T PGVTAQPDAAT +FVFNHTMLRVKDI KSLDFYTR+LGF LV+KRDFPEA Sbjct: 1 MSLHELNTFPGVTAQPDAATQKFVFNHTMLRVKDITKSLDFYTRILGFTLVEKRDFPEAE 60 Query: 61 FSLYFLALVDPAQIPADDTARHQWMKSIPGVLELTHNHGTENDADFAYHNGNTDPRGFGH 120 FSLYFLALVD QIPAD TAR +WMKSIPG+LELTHNHGTENDADFAYHNGNTDPRGFGH Sbjct: 61 FSLYFLALVDKNQIPADATARTEWMKSIPGILELTHNHGTENDADFAYHNGNTDPRGFGH 120 Query: 121 ICISVPDVRAACARFEELEVPFQKRLQDGRMNHLAFVKDPDGYWVEVIQPTEL 173 ICISVPD+ AAC RFE L FQKRL DGRM LAF+KDPD YWVE+IQP L Sbjct: 121 ICISVPDIVAACERFEALGCDFQKRLSDGRMKSLAFIKDPDAYWVEIIQPAPL 173 Lambda K H 0.323 0.139 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 175 Length of database: 173 Length adjustment: 19 Effective length of query: 156 Effective length of database: 154 Effective search space: 24024 Effective search space used: 24024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 44 (21.6 bits)
Align candidate PfGW456L13_2929 (Lactoylglutathione lyase (EC 4.4.1.5))
to HMM TIGR00068 (gloA: lactoylglutathione lyase (EC 4.4.1.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00068.hmm # target sequence database: /tmp/gapView.9570.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00068 [M=150] Accession: TIGR00068 Description: glyox_I: lactoylglutathione lyase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-52 162.7 0.0 2.4e-52 162.5 0.0 1.0 1 lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2929 Lactoylglutathione lyase (EC 4.4 Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2929 Lactoylglutathione lyase (EC 4.4.1.5) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 162.5 0.0 2.4e-52 2.4e-52 7 141 .. 14 170 .. 7 173 .] 0.97 Alignments for each domain: == domain 1 score: 162.5 bits; conditional E-value: 2.4e-52 TIGR00068 7 avedeatkkylllhtmlrvgdldksldfytevlGmkllrkkdfpeekfslaflgy 61 a+ d at+k+++ htmlrv+d+ ksldfyt++lG +l+ k+dfpe +fsl+fl+ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2929 14 AQPDAATQKFVFNHTMLRVKDITKSLDFYTRILGFTLVEKRDFPEAEFSLYFLAL 68 678999************************************************* PP TIGR00068 62 edessa...............avieLtynwgtek.....ydlGn....gfGhiai 92 d+++ ++eLt+n+gte+ y++Gn gfGhi i lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2929 69 VDKNQIpadatartewmksipGILELTHNHGTENdadfaYHNGNtdprGFGHICI 123 *****9**************99***********99******************** PP TIGR00068 93 avddvykacervkakGgkvvrepgpvkggtkviafvkDPDGykiellek 141 +v+d+ +acer++a+G ++ ++ +g++k +af+kDPD y++e+++ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2929 124 SVPDIVAACERFEALGCDFQKRL--SDGRMKSLAFIKDPDAYWVEIIQP 170 **********************9..9*********************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (150 nodes) Target sequences: 1 (173 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 4.63 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory