Align Hydroxyacylglutathione hydrolase GloC; Accessory type II glyoxalase; Glyoxalase II 2; GlxII-2; EC 3.1.2.6 (characterized)
to candidate PfGW456L13_1623 Hypothetical metal-binding enzyme, YcbL homolog
Query= SwissProt::P75849 (215 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1623 Length = 213 Score = 150 bits (378), Expect = 2e-41 Identities = 82/203 (40%), Positives = 117/203 (57%), Gaps = 3/203 (1%) Query: 7 PVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDDSGLTLMQILLTHGHLDHVGAAA 66 PV NC++I T+ A +VDPGG+ E I +D GL ++ I+ TH HLDH A+ Sbjct: 13 PVGPLQCNCTIIGDPVTKKAIVVDPGGNHELILARLDALGLKVVSIIHTHAHLDHFLASG 72 Query: 67 ELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLEECQPLTPDRWLNEGDTISIGNVTLQV 126 +L + G + KED+F L Q +MFG+ +PDRWL + + ++ G Sbjct: 73 QLKEKTGATLH-LHKEDQFLWDNLEMQCQMFGVPYTPVPSPDRWLADDEELACGCGV--A 129 Query: 127 LHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKLLPLGDDV 186 LH PGHTPG + F+ AKLLI+GD +F+ GVGR+D GD ++ SIK +L L +D Sbjct: 130 LHTPGHTPGSMSFWFSEAKLLIAGDTLFRRGVGRTDLWGGDQATIVRSIKQRLYTLDEDA 189 Query: 187 IFIPGHGPLSTLGYERLHNPFLQ 209 + GHGP + LG E NPF++ Sbjct: 190 TVVTGHGPDTRLGDEMRENPFVR 212 Lambda K H 0.321 0.142 0.453 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 215 Length of database: 213 Length adjustment: 22 Effective length of query: 193 Effective length of database: 191 Effective search space: 36863 Effective search space used: 36863 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory