Align L-threonine dehydratase biosynthetic IlvA; EC 4.3.1.19; Threonine deaminase (uncharacterized)
to candidate PfGW456L13_3031 Threonine dehydratase biosynthetic (EC 4.3.1.19)
Query= curated2:P37946 (422 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3031 Length = 337 Score = 229 bits (584), Expect = 9e-65 Identities = 134/323 (41%), Positives = 185/323 (57%), Gaps = 7/323 (2%) Query: 13 VKHILKAHQNVKDVVIHTPLQRNDRLSERYECNIYLKREDLQVVRSFKLRGAYHKMKQLS 72 VK IL A V ++ + TPLQ LSE I LKREDLQ SFK+RGAY+K+ QLS Sbjct: 15 VKKILAAP--VYELAVRTPLQPAPALSEALGNQILLKREDLQPTFSFKIRGAYNKLVQLS 72 Query: 73 SEQTENGVVCASAGNHAQGVAFSCKHLGIHGKIFMPSTTPRQKVSQVELFGKGFIDIILT 132 Q GVV ASAGNHAQGVA + + LGI+ I MP TTP+ KV V G D +L Sbjct: 73 EVQKARGVVTASAGNHAQGVALAARELGINATIVMPCTTPQLKVIGVRSRGA---DAVLH 129 Query: 133 GDTFDDVYKSAAECCEAESRTFIHPFDDPDVMAGQGTLAVEILNDIDTEPHFLFASVGGG 192 G++F A + RTF+ PFDDP+V+AGQGT+A+EIL +F VGGG Sbjct: 130 GESFPFALACALDLARETGRTFVSPFDDPEVIAGQGTVAMEILRQHQGPLDAIFVPVGGG 189 Query: 193 GLLSGVGTYLKNVSPDTKVIAVEPAGAASYFESNKAGHVVTLDKIDKFVDGAAVKKIGEE 252 GL++G+ Y+K + P+ +VI VE +A + AG V L + F DG AV +IG Sbjct: 190 GLIAGIAAYVKYLRPEVRVIGVESEHSACLQAAMHAGERVVLPSVGTFADGVAVAQIGAY 249 Query: 253 TFRTLETVVDDILLVPEGKVCTSILELYNECAVVAEPAGALSVAALDLYKDQ--IKGKNV 310 F VDD++ V ++C +I +Y++ + EP+GAL+VA + Y Q G+ + Sbjct: 250 GFEVCRFCVDDVVTVSNDELCAAIKNIYDDTRSITEPSGALAVAGIKRYVAQTGALGQTL 309 Query: 311 VCVVSGGNNDIGRMQEMKERSLI 333 V + SG N + + + ER+ + Sbjct: 310 VAIDSGANINFDSLGHVAERAAL 332 Lambda K H 0.318 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 311 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 422 Length of database: 337 Length adjustment: 30 Effective length of query: 392 Effective length of database: 307 Effective search space: 120344 Effective search space used: 120344 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate PfGW456L13_3031 (Threonine dehydratase biosynthetic (EC 4.3.1.19))
to HMM TIGR01124 (ilvA: threonine ammonia-lyase, biosynthetic (EC 4.3.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01124.hmm # target sequence database: /tmp/gapView.18034.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01124 [M=499] Accession: TIGR01124 Description: ilvA_2Cterm: threonine ammonia-lyase, biosynthetic Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-150 487.4 2.0 2.8e-150 487.1 2.0 1.0 1 lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3031 Threonine dehydratase biosynthet Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3031 Threonine dehydratase biosynthetic (EC 4.3.1.19) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 487.1 2.0 2.8e-150 2.8e-150 2 320 .. 14 332 .. 13 335 .. 0.99 Alignments for each domain: == domain 1 score: 487.1 bits; conditional E-value: 2.8e-150 TIGR01124 2 ylrailkarvyeaavetplekaaklserlknrvllkredlqpvfsfklrGaynkm 56 y+++il a vye av tpl++a lse l+n++llkredlqp fsfk+rGaynk+ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3031 14 YVKKILAAPVYELAVRTPLQPAPALSEALGNQILLKREDLQPTFSFKIRGAYNKL 68 899**************************************************** PP TIGR01124 57 aqlsaeqkakGviaasaGnhaqGvalsakklGvkavivmpettpeikvdavkafG 111 qls+ qka+Gv++asaGnhaqGval+a++lG++a+ivmp+ttp++kv v+++G lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3031 69 VQLSEVQKARGVVTASAGNHAQGVALAARELGINATIVMPCTTPQLKVIGVRSRG 123 ******************************************************* PP TIGR01124 112 gevvlhGenydeakakalelaqekgltfiapfddplviaGqGtvalellrqveed 166 ++ vlhGe++ a a al+la+e g tf++pfddp viaGqGtva+e+lrq++ + lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3031 124 ADAVLHGESFPFALACALDLARETGRTFVSPFDDPEVIAGQGTVAMEILRQHQGP 178 ******************************************************* PP TIGR01124 167 ldavfvpvGGGGliaGvaalvkqllpeikvigveaedsaalkqaleaGervkldq 221 lda+fvpvGGGGliaG+aa+vk l+pe++vigve+e sa+l++a++aGerv l + lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3031 179 LDAIFVPVGGGGLIAGIAAYVKYLRPEVRVIGVESEHSACLQAAMHAGERVVLPS 233 ******************************************************* PP TIGR01124 222 vGlfadGvavkevGdetfrlckeylddivlvdtdevcaaikdvfedtravlepaG 276 vG fadGvav ++G++ f++c+ +dd+v+v de+caaik++++dtr+++ep+G lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3031 234 VGTFADGVAVAQIGAYGFEVCRFCVDDVVTVSNDELCAAIKNIYDDTRSITEPSG 288 ******************************************************* PP TIGR01124 277 alalaGlkkyvakkgiedktlvailsGanlnfdrlryvserael 320 ala+aG+k+yva+ g+ ++tlvai sGan+nfd+l +v+era l lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3031 289 ALAVAGIKRYVAQTGALGQTLVAIDSGANINFDSLGHVAERAAL 332 *****************************************976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (499 nodes) Target sequences: 1 (337 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 8.38 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory