Align Glyoxal reductase; GR; Methylglyoxal reductase; EC 1.1.1.-; EC 1.1.1.283 (characterized)
to candidate PfGW456L13_1417 oxidoreductase, aldo/keto reductase family
Query= SwissProt::O32210 (276 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1417 Length = 277 Score = 155 bits (393), Expect = 7e-43 Identities = 92/255 (36%), Positives = 139/255 (54%), Gaps = 3/255 (1%) Query: 14 GVEMPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKESGVAREE 73 G+ MP GLG + + G E T +V+ A+ GYR IDTAA Y NE+ VG + S RE+ Sbjct: 9 GLNMPKLGLGTWPML-GEECTRAVEQALALGYRHIDTAAAYNNEDAVGQALANSPTPREQ 67 Query: 74 LFITSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWPGKD-KYKDTWRALEKLYKD 132 + +T+KVW + + + ++SL+ L+ +Y+DL+++HWP D T L + Sbjct: 68 IHVTTKVWWDQLQPDAMRHSMDRSLKALRSEYVDLFMLHWPTTDWDLPRTIETLVSFREQ 127 Query: 133 GKIRAIGVSNFQVHHLEELLKDAEIKPMVNQVEFHPRLTQKELRDYCKGQGIQLEAWSPL 192 G R IGV+NF +H L +++++ QVE+H L Q L DY + Q + L A++PL Sbjct: 128 GLARNIGVANFPLHLLRKVVEELGAPLSAIQVEYHVLLGQNALLDYARQQDLALTAYTPL 187 Query: 193 MQGQLLDNEVLTQIAEKHNKSVAQVILRWDL-QHGVVTIPKSIKEHRIIENADIFDFELS 251 + ++ D + +IA KH QV L+W L Q V IPK+ E + N D L Sbjct: 188 ARNKVSDIPAIRRIAAKHGVLPTQVALKWLLDQPNVAAIPKASSEPNQLANLAALDVRLD 247 Query: 252 QEDMDKIDALNKDER 266 ED I +L+K ER Sbjct: 248 DEDRALIASLSKRER 262 Lambda K H 0.316 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 277 Length adjustment: 25 Effective length of query: 251 Effective length of database: 252 Effective search space: 63252 Effective search space used: 63252 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory