Align Glyoxal reductase; GR; Methylglyoxal reductase; EC 1.1.1.-; EC 1.1.1.283 (characterized)
to candidate PfGW456L13_2401 Methylglyoxal reductase, acetol producing (EC 1.1.1.-) / 2,5-diketo-D-gluconic acid reductase B (EC 1.1.1.274)
Query= SwissProt::O32210 (276 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2401 Length = 267 Score = 167 bits (424), Expect = 2e-46 Identities = 95/257 (36%), Positives = 149/257 (57%), Gaps = 5/257 (1%) Query: 15 VEMPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKESGVAREEL 74 + +P FGLG F+++ G +SV A+ GYR IDTA IY+NE VG I SG+AREEL Sbjct: 1 MSIPAFGLGTFRLQ-GQVVIDSVSTALALGYRVIDTAQIYENEADVGEAIAASGIAREEL 59 Query: 75 FITSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWPGKD---KYKDTWRALEKLYK 131 FITSK+W + + + + ++SL +LQ DYLDL LIHWP D ++ AL + Sbjct: 60 FITSKIWVANLAGDRLIDSLKESLRKLQTDYLDLTLIHWPSPDDQVPVEEFMGALLEAKH 119 Query: 132 DGKIRAIGVSNFQVHHLEELLKDAEIKPM-VNQVEFHPRLTQKELRDYCKGQGIQLEAWS 190 G R IGVSNF + +++ + + + +Q+E HP L +E+ ++ + +GI + ++ Sbjct: 120 LGLTRQIGVSNFTIDLMKQAIAATGAEHIATHQIELHPYLQNREVVEFARSRGIGITSYM 179 Query: 191 PLMQGQLLDNEVLTQIAEKHNKSVAQVILRWDLQHGVVTIPKSIKEHRIIENADIFDFEL 250 L G++L + ++ QIAE+ + + AQV L W +Q G IP S + + N + L Sbjct: 180 TLAYGEVLKDPLIQQIAERLHATPAQVTLAWAMQSGYAVIPSSTRRANLESNLKARELTL 239 Query: 251 SQEDMDKIDALNKDERV 267 S+ DM I L++ R+ Sbjct: 240 SEADMALIATLDRGHRL 256 Lambda K H 0.316 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 267 Length adjustment: 25 Effective length of query: 251 Effective length of database: 242 Effective search space: 60742 Effective search space used: 60742 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory