Align Trehalose import ATP-binding protein SugC; EC 7.5.2.- (characterized)
to candidate PfGW456L13_1799 Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)
Query= SwissProt::P9WQI3 (393 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1799 Length = 351 Score = 259 bits (661), Expect = 1e-73 Identities = 149/317 (47%), Positives = 199/317 (62%), Gaps = 12/317 (3%) Query: 1 MAEIVLDHVNKSYPDGHTAVRDLNLTIADGEFLILVGPSGCGKTTTLNMIAGLEDISSGE 60 M+ ++L++V K Y AV+D+NL + +G+ + +GPSGCGKTT L MIAGLE +S GE Sbjct: 1 MSGLILENVEKHYGSA-CAVKDVNLHLPEGKLVCFLGPSGCGKTTLLRMIAGLETLSGGE 59 Query: 61 LRIAGERVNEKAPKDRDIAMVFQSYALYPHMTVRQNIAFPLTLAKMRKADIAQKVSETAK 120 +R+ GE + R+ MVFQS AL+PHMTV +NIA+PL L + KAD +V E + Sbjct: 60 IRLDGEDIGHTPAHLRNFGMVFQSLALFPHMTVGENIAYPLKLRGVSKADQQARVVELLE 119 Query: 121 ILDLTNLLDRKPSQLSGGQRQRVAMGRAIVRHPKAFLMDEPLSNLDAKLRVQMRGEIAQL 180 ++ L +++R ++LSGGQRQRVA+ RAI HPK L+DEPLS LDAKLR M+ EI QL Sbjct: 120 LIQLQAMINRPVAKLSGGQRQRVAIARAIANHPKILLLDEPLSALDAKLRESMQVEIRQL 179 Query: 181 QRRLGTTTVYVTHDQTEAMTLGDRVVVMYGGIAQQIGTPEELYERPANLFVAGFIGSPAM 240 Q+RL TT+ VTHDQ EAMT+ D VVV+ QQ+GTP E+Y PAN FVA FIGS Sbjct: 180 QQRLNITTIMVTHDQREAMTMADIVVVLGEHKVQQVGTPIEIYRHPANEFVADFIGSG-- 237 Query: 241 NFFPARLTAIG-LTLPFGEVTLAPEVQGVIAAHPKPENVIVGVRPEHIQDAALIDAYQRI 299 N FPA + G ++LP G+ P ++ E V + +RPE +Q + A Q Sbjct: 238 NIFPATVLGNGKVSLPGGDALQVPICSSIVVG----EKVKMLIRPEDLQ----LSAPQAT 289 Query: 300 RALTFQVKVNLVESLGA 316 KV V +GA Sbjct: 290 AGNRLLGKVTFVRDIGA 306 Lambda K H 0.319 0.135 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 336 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 351 Length adjustment: 30 Effective length of query: 363 Effective length of database: 321 Effective search space: 116523 Effective search space used: 116523 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory