Align tryptophan permease (characterized)
to candidate PfGW456L13_4291 Aromatic amino acid transport protein AroP
Query= CharProtDB::CH_091156 (592 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4291 Length = 467 Score = 211 bits (537), Expect = 5e-59 Identities = 133/394 (33%), Positives = 209/394 (53%), Gaps = 10/394 (2%) Query: 78 LKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIGWAIAGSQIIGTIHGLGEI 137 LKR LK RH+ +IA+GG+IGTGLF+GS + GP +++G+AIAG + LGE+ Sbjct: 11 LKRGLKNRHIQLIALGGAIGTGLFLGSAGVLKSAGP-SMILGYAIAGFIAFLIMRQLGEM 69 Query: 138 TVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVI 197 V PV G+F+++ ++ F+ Y + + V E+ A VQ+W + + Sbjct: 70 IVEEPVAGSFSHFAHKYWGGYAGFLSGWNYWVLYVLVGMAELTAVGKYVQFWWPEVPSWV 129 Query: 198 WVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFIIL-CVVLICG-GGPDHEFIGA 255 A+F+ ++ IN+ V+ FGE EF F+ IK + + G I L C +L G GGP + Sbjct: 130 SAAVFFVLVNLINMMNVKVFGEMEFWFAIIKVVAIIGMIALGCYMLFSGTGGPQASV--S 187 Query: 256 KYWHDPGCLANGFPGVLSVLVVASYSLGGIEMTCLASGETDPKG--LPSAIKQVFWRILF 313 W G NG+ G+L + +S GG+E+ + + E G +P AI QV +R+L Sbjct: 188 NLWDHGGFFPNGYSGLLMAMAFIMFSFGGLELVGITAAEASEPGKVIPKAINQVVYRVLI 247 Query: 314 FFLISLTLVGFLVPYTN--QNL-LGGSSVDNSPFVIAIKLHHIKALPSIVNAVILISVLS 370 F++ +LT++ L P+ Q L G + SPFV L I+N V+L + LS Sbjct: 248 FYVGALTVLLSLYPWDQLLQTLGASGDAYGGSPFVQIFSLIGSDTAAHILNFVVLTAALS 307 Query: 371 VGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMSEV 430 V NS ++ +SR L +A QG P +++ G PL+ + ++L LL+ LV + E Sbjct: 308 VYNSGVYCNSRMLYGLAEQGDAPKALMKLNKQGVPLLALGVSALITLLSVLVNYLAPHEA 367 Query: 431 FNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQG 464 L A+ + I W I+L+H++FR M QG Sbjct: 368 LELLFALVVASLMINWAMISLTHLKFRKIMSQQG 401 Lambda K H 0.326 0.141 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 750 Number of extensions: 42 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 592 Length of database: 467 Length adjustment: 35 Effective length of query: 557 Effective length of database: 432 Effective search space: 240624 Effective search space used: 240624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory