Align Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale)
to candidate PfGW456L13_483 Sulfate and thiosulfate import ATP-binding protein CysA (EC 3.6.3.25)
Query= uniprot:P70970 (276 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_483 Length = 329 Score = 135 bits (341), Expect = 9e-37 Identities = 86/218 (39%), Positives = 128/218 (58%), Gaps = 14/218 (6%) Query: 9 ALYDINASIKEGSYVAVIGHTGSGKSTLLQHLNGLLKPTKGQISLGSTVIQAGKKNKDLK 68 AL +I+ I+ G VA++G +G GK+TLL+ + GL P +G I + +G +D Sbjct: 17 ALDNISLDIQSGELVALLGPSGCGKTTLLRIIAGLETPDQGNIVFHGEDV-SGHDVRD-- 73 Query: 69 KLRKKVGIVFQFPEHQLFEE-TVLKDISFG----PMNFGVKKEDAEQKAREMLQLVGLSE 123 + VG VFQ + LF TV +++FG P N + K E+L +V L + Sbjct: 74 ---RNVGFVFQ--HYALFRHMTVFDNVAFGLRMKPKNQRPSESQIATKVHELLNMVQL-D 127 Query: 124 ELLDRSPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGLDPRGRKEIMDMFYELHQRGN 183 L DR P +LSGGQ +R+A+A LA++P+VL+LDEP LD + RKE+ LH+ N Sbjct: 128 WLSDRYPEQLSGGQRQRIALARALAVEPKVLLLDEPFGALDAKVRKELRRWLARLHEDIN 187 Query: 184 LTTILVTHSMEDAAAYADEMIVMHKGTIQASGSPRDLF 221 LT++ VTH E+A AD ++VM+KG I+ GSP D++ Sbjct: 188 LTSVFVTHDQEEAMEVADRIVVMNKGVIEQIGSPGDVY 225 Lambda K H 0.318 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 329 Length adjustment: 27 Effective length of query: 249 Effective length of database: 302 Effective search space: 75198 Effective search space used: 75198 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory