Align 2-oxo-3-hexenedioate decarboxylase (EC 4.1.1.77) (characterized)
to candidate PfGW456L13_2504 4-oxalocrotonate decarboxylase (EC 4.1.1.77)
Query= metacyc::MONOMER-15110 (260 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2504 Length = 263 Score = 164 bits (416), Expect = 1e-45 Identities = 95/250 (38%), Positives = 140/250 (56%), Gaps = 3/250 (1%) Query: 7 KDLARFLVDAEVEKKEVLKLTNEHPDLTVEDGYAIQEQLVQMKLEQGYRIVGPKMGLTSQ 66 ++ L A + + LT P +++ED Y I ++ ++ G +IVG K+G+TS Sbjct: 7 REFGEELYQALLSGSTLAPLTERWPSISIEDAYHISLYAIERRVAAGDQIVGKKIGVTSA 66 Query: 67 AKMKQMNVNEPIYGYIFDYMVVNGQ---ELSMSELIHPKVEAEIAFILGKDIEGPGITGA 123 A + +NV++P +G+I M + LS ++LI P+ E EIAF L D+ GPGIT A Sbjct: 67 AVQQMLNVHQPDFGFITRQMSFDDDAQISLSANKLIQPRAEGEIAFKLKHDLVGPGITEA 126 Query: 124 QVLAATEYVVPALEIIDSRYQNFQFTLPDVIADNASSSRVFLGSTIKRPDNMELDLLGVT 183 VLAATEYV+P EI+DSR +++ + D +ADNAS LG + P ++L L + Sbjct: 127 DVLAATEYVMPCFEIVDSRIHDWRIRIQDTVADNASCGVFVLGDSKVDPRELDLPNLRMR 186 Query: 184 LSINGQIKDLGAGAAVVGHPANSVAMLANMLARKGLKLKAGQIILSGGITGAVMLNVGDS 243 + N + G G+AV G+P +VA LAN L G+ KAG+IILSG + GD Sbjct: 187 VFKNAEPLSEGLGSAVQGNPLTAVAWLANTLGAFGIPFKAGEIILSGSLVPLEPARAGDR 246 Query: 244 VTGKFDGLGT 253 DGLG+ Sbjct: 247 FELTIDGLGS 256 Lambda K H 0.317 0.137 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 263 Length adjustment: 25 Effective length of query: 235 Effective length of database: 238 Effective search space: 55930 Effective search space used: 55930 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory