Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate PfGW456L13_122 Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)
Query= uniprot:A0A165KER0 (358 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_122 Length = 427 Score = 249 bits (637), Expect = 7e-71 Identities = 155/353 (43%), Positives = 212/353 (60%), Gaps = 48/353 (13%) Query: 4 TKTNWIIGAVALLVLPLILQSFGNAWVR-IADLALLYVLLALGLNIVVGYAGLLDLGYVA 62 ++ WII ++V+ ++ F N+++ + L L+YVLL LGLNIVVG AGLLDLGYVA Sbjct: 95 SRLRWIIPL--MIVIAVVFPFFSNSYLLGVVILGLIYVLLGLGLNIVVGLAGLLDLGYVA 152 Query: 63 FYAVGAYLFALMASPHLADNFAAFAAMFPNGLHTSLWIVIPVAALLAAFFGAMLGAPTLK 122 FYA+GAY AL +L F W V+P+AA+ A G +LG P L+ Sbjct: 153 FYAIGAYGLAL-GYQYLGLGF---------------WTVLPLAAITAGLAGCILGFPVLR 196 Query: 123 LRGDYLAIVTLGFGEIIRIFLNNLDHPVNLTNGPKGLGQIDSVKVFGLDLGKRL------ 176 L GDYLAIVTLGFGEIIR+ LNN + LT GP G+ FG++ GKR Sbjct: 197 LHGDYLAIVTLGFGEIIRLILNNW---LTLTGGPNGMAA-PLPTFFGIEFGKRAKEGGVP 252 Query: 177 --EVFGFDINSVTLYYYLFLVL--VVVSVI-ICYRLQDSRIGRAWMAIREDEIAAKAMGI 231 E FG N YY+++ VL VV++V+ I +RL +GRAW A+REDEIA ++MG+ Sbjct: 253 FHEFFGIAYNPDVKYYFIYAVLFLVVLAVLHIKHRLTRMPVGRAWEALREDEIACRSMGL 312 Query: 232 NTRNMKLLAFGMGASFGGVSGAMFGAFQGFVSPESFSLMESVMIVAMVVLGGIGHIPGVI 291 N +KL AF +GAS G++G F +QGFV+P SF+ ES +I+A+VVLGG+G GV+ Sbjct: 313 NHVLVKLSAFTIGASTAGLAGVFFATYQGFVNPTSFTFFESALILAIVVLGGMGSTIGVV 372 Query: 292 LGAVLLSALPEVLRYVAGPLQAMTDGRLDSAILRQLLIALAMIIIMLLRPRGL 344 + A +L+ PE+LR A R LL + M+++M+ RPRGL Sbjct: 373 IAAFVLTVAPELLR--------------GFAEYRVLLFGILMVLMMIWRPRGL 411 Lambda K H 0.328 0.144 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 431 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 427 Length adjustment: 31 Effective length of query: 327 Effective length of database: 396 Effective search space: 129492 Effective search space used: 129492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory