Align isobutyryl-CoA dehydrogenase (EC 1.3.8.1) (characterized)
to candidate PfGW456L13_1630 Butyryl-CoA dehydrogenase (EC 1.3.99.2)
Query= reanno::psRCH2:GFF2392 (383 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1630 Length = 378 Score = 263 bits (673), Expect = 5e-75 Identities = 143/373 (38%), Positives = 214/373 (57%), Gaps = 1/373 (0%) Query: 6 LSEDQRMIRDMARDFARREIAPHAQAWEKAGWIDDTLVAQMGELGLLGMVVPEEWGGSYI 65 LS + + RD R F +E P WEK G+ID L + GE G+L +PEE+GG Sbjct: 7 LSPEHELFRDSVRTFLEKEAVPFHGQWEKQGYIDRKLWNKAGEAGMLCSHLPEEYGGLGA 66 Query: 66 DYVAYALAVEEISAGDGATGALMSIHNSVGCGPVLNYGSQAQKDEWLTELASGRAIGCFA 125 D++ A+ +EE+ G TG S+H+ + +L+YGS+ K ++L +L SG + A Sbjct: 67 DFLYSAVVIEEVGRL-GLTGIGFSLHSDIVAPYILHYGSETLKHKYLPKLVSGEMVTAIA 125 Query: 126 LTEPQAGSEAHNLRTRAELVDGHWVLNGSKQFCSNAKRSKLAIVFAVTDPELGKKGLSAF 185 +TEP AGS+ ++T A L +V+NGSK F +N + L IV A TDP+ G KG S F Sbjct: 126 MTEPGAGSDLQGVKTTAVLDGDEYVINGSKTFITNGYLADLVIVVAKTDPKAGAKGTSLF 185 Query: 186 LVPTDTPGFAVERSEHKMGIRASDTCGVSLSDCRIPEANLLGERGKGLAIALSNLEGGRI 245 LV +TPGF + K+G++A DT + D R+P+ NLLG+ G G A + L R+ Sbjct: 186 LVEANTPGFDKGKRLEKVGMKAQDTSELFFQDVRVPKENLLGQAGMGFAYLMQELPQERL 245 Query: 246 GIGAQALGIARAAFEAALLYARERVQFGKPIAEHQSIANMLADMQTQLNAARLLILHAAR 305 + L A AA + L Y RER FGK IA+ Q+ LA+M T++ R+ + Sbjct: 246 TVAIGGLASAEAALQWTLDYTRERKAFGKSIADFQNTRFKLAEMATEIQIGRVFVDRCLE 305 Query: 306 LKSAGLPCLSEASQAKLFASEMAEKVCSQAVQIHGGYGYLEDYPVERYYRDARITQIYEG 365 L G + A+ AK + +++ KV + VQ+HGGYG++ +YP+ R + DAR+ +IY G Sbjct: 306 LHLQGKLDVPTAAMAKYWGTDLQCKVLDECVQLHGGYGFMWEYPIARAWADARVQRIYAG 365 Query: 366 SSEIQRLLIAREL 378 ++EI + +IAR L Sbjct: 366 TNEIMKEIIARSL 378 Lambda K H 0.318 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 326 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 378 Length adjustment: 30 Effective length of query: 353 Effective length of database: 348 Effective search space: 122844 Effective search space used: 122844 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory