Align 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) (characterized)
to candidate PfGW456L13_2984 Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17)
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2986 (356 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2984 Length = 257 Score = 103 bits (257), Expect = 5e-27 Identities = 64/194 (32%), Positives = 105/194 (54%), Gaps = 11/194 (5%) Query: 8 VLAEVRNHIGHLTLNRPAGLNALTLDMVRNLHRQLDAWAQDSQVHAVVLRGAGEKAFCAG 67 +L E +G +TLNRP LNAL +V L++ LD + DS + +VL G+ +KAF AG Sbjct: 6 ILLETHGRVGLITLNRPQALNALNAQIVSELNQALDGFEADSNIGCIVLTGS-KKAFAAG 64 Query: 68 GDIRSLHDSFKSGDTLHEDFFVEEYALDL-AIHHYRKPVLALMDGFVLGGGMGLVQGADL 126 DI+ + + + ++++ D + + RKP++A ++GF LGGG L D Sbjct: 65 ADIKEM------AELTYPQIYIDDLFSDSDRVANRRKPIIAAVNGFALGGGCELALMCDF 118 Query: 127 RVVTEKSRLAMPEVGIGYFPDVGGSYFLSRIPGEL-GIYLGVSGVQIRAADALYCGLADW 185 + + +R PE+ +G P +GG+ L+R G+ + + +SG I A +A CG+ Sbjct: 119 ILAGDNARFGQPEINLGVLPGMGGTQRLTRAVGKAKAMEMCLSGRLIDAVEAERCGIVAR 178 Query: 186 YLESGKLGVLDEKL 199 + S +L LDE L Sbjct: 179 IVPSDEL--LDEAL 190 Lambda K H 0.322 0.139 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 257 Length adjustment: 27 Effective length of query: 329 Effective length of database: 230 Effective search space: 75670 Effective search space used: 75670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory