Align 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) (characterized)
to candidate PfGW456L13_4531 Enoyl-CoA hydratase (EC 4.2.1.17)
Query= reanno::pseudo1_N1B4:Pf1N1B4_4790 (356 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4531 Length = 370 Score = 234 bits (598), Expect = 2e-66 Identities = 139/342 (40%), Positives = 193/342 (56%), Gaps = 12/342 (3%) Query: 16 IGHLTLNRPAGLNAITLDMVRSLQQQLDAWAQDPQVHAVVLRGAGEKAFCAGGDIRSLYD 75 IG +L+ LNA++L M+ +L+ ++ AWA+DPQ+ V+LRG G KAFCAGG++RSL + Sbjct: 16 IGIASLDAEKSLNALSLPMINALRDRMGAWAKDPQIVCVLLRGNGAKAFCAGGEVRSLVE 75 Query: 76 SFK--SGDT--LHEDFFVEEYALDLAIHHYRKPVLALMDGFVLGGGMGLVQGADLRVVTE 131 + + G+ L FF EY LD +H Y KP++ G+VLGGGMGL+QGA +R+VT Sbjct: 76 ACRVHPGEVPPLAAQFFAAEYRLDFKLHTYPKPLICWGHGYVLGGGMGLLQGAGIRIVTP 135 Query: 132 RSRLAMPEVAIGYFPDVGGSHFLPRVPGELGIYLGVSGVQIRAADALYCGLADWYLESNK 191 SRLAMPE++IG +PDVG S FL R+PG+LG++LG++G + DA+ LAD +L + Sbjct: 136 SSRLAMPEISIGLYPDVGASWFLSRLPGKLGLFLGLTGAHMNGRDAIDLDLADRFLLDEQ 195 Query: 192 LGTLDEQLDQLQWHETPLKDLQGLLAKL---AVQQLPAAPLAALRPAIDHFFALPDVPSM 248 L E L QL W E L LL L AV Q+P A R ID + DV Sbjct: 196 QPELIEGLLQLNWQEQTPMQLNSLLKALQQEAVAQMPEAQWLPRRQQIDELLDVSDVRC- 254 Query: 249 VEQLRAVTVADSHE--WATATADLLESRSPLAMGVTLEMLRRGRHLSLEQCFALELHLDR 306 +A++ H + A L +PL + E + R RHLSL + F +E L Sbjct: 255 --AWKAISALRDHTDLLLSRAARTLSEGAPLTARLVWEQIIRARHLSLAEVFQMEYTLSL 312 Query: 307 QWFERGDLIEGVRALLIDKDKNPRWSPPTLQALDAGHVASFF 348 + EGVRA LIDKD+ P W P + + V + F Sbjct: 313 NCCRHPEFSEGVRARLIDKDQKPHWHWPDINNVPDAVVEAHF 354 Lambda K H 0.322 0.138 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 370 Length adjustment: 29 Effective length of query: 327 Effective length of database: 341 Effective search space: 111507 Effective search space used: 111507 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory