Align methylmalonyl-CoA epimerase (EC 5.1.99.1) (characterized)
to candidate PfGW456L13_1425 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)
Query= metacyc::MONOMER-17285 (139 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1425 Length = 633 Score = 47.8 bits (112), Expect = 3e-10 Identities = 31/105 (29%), Positives = 54/105 (51%), Gaps = 7/105 (6%) Query: 5 IDHIGLVVA--DLDAAIDFYRTAYDVTEWERIELPERHALIG--VARFGDVLIELIAPTS 60 IDH+ + + LD+ + FY++ D + + LP+ + L+ R D I L S Sbjct: 439 IDHMAMALPADSLDSWVLFYKSLLDFEADDEVVLPDPYGLVKSRALRSRDSSIRLPLNIS 498 Query: 61 DQASFA---RFLREKGPGMHHIAYRVDDIYAALATLQARGLPLID 102 + + A +G G+HHIA+ DDI+A ++ + G+PL+D Sbjct: 499 ENRNTAISHALSSYRGSGVHHIAFDCDDIFAQVSRAKEAGVPLLD 543 Score = 23.1 bits (48), Expect = 0.008 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 5/63 (7%) Query: 39 RHALIGVARFGDVLIELIAPTSDQASFAR-FLREKGPGMHHIAYRVDDIYAALATLQA-R 96 R + + R GD+ + L S+ SF F GP + A RV D +ALA A + Sbjct: 328 RSKSVSLMRQGDINLIL---NSEPYSFGHSFFEAHGPSLCATAVRVKDSASALARAVAYK 384 Query: 97 GLP 99 G P Sbjct: 385 GQP 387 Lambda K H 0.326 0.142 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 139 Length of database: 633 Length adjustment: 26 Effective length of query: 113 Effective length of database: 607 Effective search space: 68591 Effective search space used: 68591 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory