Align methylmalonyl-CoA epimerase (EC 5.1.99.1) (characterized)
to candidate PfGW456L13_3114 Lactoylglutathione lyase and related lyases
Query= BRENDA::Q8RCQ6 (150 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3114 Length = 144 Score = 59.7 bits (143), Expect = 2e-14 Identities = 29/88 (32%), Positives = 53/88 (60%), Gaps = 3/88 (3%) Query: 52 FNGRPTKARAKLAFFELGPLQLELIEPDENPSTWREFLDKNGEGIHHIAFVVKDM--DRK 109 ++G P + K+ F + G + EL+EP P+ + +FL+K+GEGI H+A+ ++ + + Sbjct: 27 YHGEPAEFVLKVCFAQSGNMVWELMEPVSGPTIFADFLEKHGEGIQHVAYDCNNIPFEDR 86 Query: 110 VEELYRKGMKVIQKGDFEG-GRYAYIDT 136 + EL R+G K +Q G + G +A+ T Sbjct: 87 ITELTRRGFKCVQSGSWMGVNHFAFFGT 114 Lambda K H 0.320 0.139 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 63 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 150 Length of database: 144 Length adjustment: 16 Effective length of query: 134 Effective length of database: 128 Effective search space: 17152 Effective search space used: 17152 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 42 (20.8 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory