Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate PfGW456L13_4610 Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)
Query= TCDB::Q8DQH7 (236 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4610 Length = 255 Score = 143 bits (360), Expect = 4e-39 Identities = 87/251 (34%), Positives = 141/251 (56%), Gaps = 20/251 (7%) Query: 3 VLKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTILRTLSGLVRPSSGKIEF 62 +LKVENLS+ +G + AV V+ V E +VV+LIG NGAGKTT+ L+G +PS G I Sbjct: 5 ILKVENLSMRFGGLLAVNGVALSVKEKQVVALIGPNGAGKTTVFNCLTGFYKPSGGSILL 64 Query: 63 LGQEIQKMPAQKIVAGGLSQVPEGRHVFPGLTVMENL-----------------EMGAFL 105 G+ I+ +P KI G+ + + +F +T +ENL + +F Sbjct: 65 DGEAIEGLPGHKIALKGVVRTFQNVRLFKDMTAVENLLIAQHRHLNTNFLSGLFKTPSFR 124 Query: 106 KKNREENQANLKKVFSRFPRLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEPSM 165 K RE + + + L+E N+ A TL+ G+Q+ L + R +M+ P++L+LDEP+ Sbjct: 125 KSERE--AMDFAEFWLEKVNLKEFANRPAGTLAYGQQRRLEIARCMMTRPRILMLDEPAA 182 Query: 166 GLAPIFIQEIFDIIQDIQKQ-GTTVLLIEQNANKALAISDRGYVLETGKIVLSGTGKELA 224 GL P +++ +I ++++ TVLLIE + ++ISD V+ G + +GT +++ Sbjct: 183 GLNPKETEDLKALISMLREEHNVTVLLIEHDMKLVMSISDHIVVINQGTPLANGTPEQIR 242 Query: 225 SSEEVRKAYLG 235 + EV KAYLG Sbjct: 243 DNPEVIKAYLG 253 Lambda K H 0.315 0.134 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 255 Length adjustment: 24 Effective length of query: 212 Effective length of database: 231 Effective search space: 48972 Effective search space used: 48972 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory