Align D-xylulose reductase (EC 1.1.1.9) (characterized)
to candidate PfGW456L13_3453 Short-chain dehydrogenase/reductase SDR
Query= BRENDA::Q8GR61 (262 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3453 Length = 272 Score = 122 bits (305), Expect = 1e-32 Identities = 86/267 (32%), Positives = 129/267 (48%), Gaps = 28/267 (10%) Query: 3 KKFNGKVCLVTGAGGNIGLATALRLAEEGTAIALLDMNREALEKAEASVREKGVEARSYV 62 K+ +GKVC++TGAG IG A+ALR A EG + + D+ E A+A E GV A Sbjct: 6 KRLDGKVCVITGAGSGIGRASALRFAREGATVVVTDL---FAESAQAVAAEIGVNALVLQ 62 Query: 63 CDVTSEEAVIGTVDSVVRDFGKIDFLFNNAGYQGAFAPVQD-----YPSDDFARVLTINV 117 DV E+A+ V+ VR FG+ID LFNNA Y+ A +D + ++ F + +NV Sbjct: 63 VDVGQEDALREMVEQTVRTFGRIDVLFNNAVYRNP-ATTRDIDFINFNTELFHNCMRVNV 121 Query: 118 TGAFHVLKAVSRQMITQNYGRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAP 177 G K M+ Q G I+ T+S + + G + +YG SK A+ +T A Sbjct: 122 LGGVLACKYALPHMLAQGSGSILFTSSTSSIAGEISQFSYGASKAALNWYVQTIAATFGK 181 Query: 178 YNIRVNAISPGYMGPGFM--WERQVELQAKVGSQYFSTDPKVVAQQMIGSVPMRRYGDIN 235 IR N I PG + M W + A + Q +VP + G+ Sbjct: 182 RGIRCNGILPGVIRTPAMESWANEAMKSAFLDLQ---------------NVP--QLGEPE 224 Query: 236 EIPGVVAFLLGDDSSFMTGVNLPIAGG 262 +I + AFL DD++++ G + + GG Sbjct: 225 DIAAMAAFLASDDAAYVNGTLMRVDGG 251 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 272 Length adjustment: 25 Effective length of query: 237 Effective length of database: 247 Effective search space: 58539 Effective search space used: 58539 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory