Align xylono-1,5-lactonase (EC 3.1.1.110) (characterized)
to candidate PfGW456L13_2118 L-arabinolactonase (EC 3.1.1.15)
Query= metacyc::MONOMER-20628 (289 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2118 Length = 291 Score = 140 bits (354), Expect = 3e-38 Identities = 104/286 (36%), Positives = 144/286 (50%), Gaps = 27/286 (9%) Query: 12 KATLGEGPIWHGDT--LWFVDIKQRKIHNYHPATGERFSFDAPDQVTFLAPIVGATGFVV 69 +A LGEGP W T L++VDI ++ A + + P+ V+ P +V Sbjct: 10 RARLGEGPFWDAPTQALYWVDIAGKQALRLIGANVQIWQM--PEHVSAFIPCESGDA-LV 66 Query: 70 GLKTGIHRFH---PATGFSLLLE-VEDAALNNRPNDATVDAQGRLWFGTMHD-----GEE 120 L +G++R P L L V D NRPN+A DAQGRLW GTM + GE+ Sbjct: 67 ALSSGVYRLDLDSPGLAPRLTLFCVADPQPGNRPNEARCDAQGRLWLGTMQNNIGANGED 126 Query: 121 ----NNSGSLYRMDLTG-VARMDRDICITNGPCVSPDGKTFYHTDTLEKTIYAFDLAEDG 175 + SG L+R+D G VA + R++ I N S D + Y D+L+ T+Y + DG Sbjct: 127 LPIVHRSGGLFRIDRAGRVAPLLRNLGIPNTLLWSDDATSVYFGDSLDGTLYRHFIRTDG 186 Query: 176 LLSNKRVFVQFALGDDVYPDGSVVDSEGYLWTALWGGFGAVRFSPQGDAVTRIELPAPNV 235 L +V+ F + PDGS +D+EG++W A W G +R S G IELP Sbjct: 187 ALDAPQVW--FGPHERGVPDGSAMDAEGFIWNARWDGNCLLRLSLDGKVDRIIELPVSRP 244 Query: 236 TKPCFGGPDLKTLYFTTARKGLSDETLAQYPLAGGVFAVPVDVAGQ 281 T FGG DLKTLY T+A L +PL G V ++ VDV G+ Sbjct: 245 TSCVFGGSDLKTLYITSAASPLG------HPLDGAVLSIAVDVPGK 284 Lambda K H 0.321 0.139 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 353 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 291 Length adjustment: 26 Effective length of query: 263 Effective length of database: 265 Effective search space: 69695 Effective search space used: 69695 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory