Align D-xylose reductase (EC 1.1.1.307) (characterized)
to candidate PfGW456L13_1417 oxidoreductase, aldo/keto reductase family
Query= BRENDA::P31867 (318 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1417 Length = 277 Score = 135 bits (341), Expect = 9e-37 Identities = 94/308 (30%), Positives = 149/308 (48%), Gaps = 49/308 (15%) Query: 9 GYDMPAVGFGCWKVDVDTCSEQIYRAIKTGYRLFDGAEDYANEKLVGAGVKKAIDEGIVK 68 G +MP +G G W + + C+ + +A+ GYR D A Y NE VG +A+ Sbjct: 9 GLNMPKLGLGTWPMLGEECTRAVEQALALGYRHIDTAAAYNNEDAVG----QALANSPTP 64 Query: 69 REDLFLTSKLWNNYHHPDNVEKALNRTLSDLQVDYVDLFLIHFPVTFKFVPLEEKYPPGF 128 RE + +T+K+W + PD + +++R+L L+ +YVDLF++H+P T Sbjct: 65 REQIHVTTKVWWDQLQPDAMRHSMDRSLKALRSEYVDLFMLHWPTT-------------- 110 Query: 129 YCGKGDNFDYEDVPILETWKALEKLVKAGKIRSIGVSNFPGALLLDLLRGATIKPSVLQV 188 D + T + L + G R+IGV+NFP LL ++ S +QV Sbjct: 111 -----------DWDLPRTIETLVSFREQGLARNIGVANFPLHLLRKVVEELGAPLSAIQV 159 Query: 189 EHHPYLQQPRLIEFAQSRGIAVTAYSSFGPQSFVELNQGRALNTSPLFENETIKAIAAKH 248 E+H L Q L+++A+ + +A+TAY+ L + + + I+ IAAKH Sbjct: 160 EYHVLLGQNALLDYARQQDLALTAYT--------------PLARNKVSDIPAIRRIAAKH 205 Query: 249 GKSPAQVLLRW-SSQRGIAIIPKSNTVPRLLENKDVNSFDLDEQDFADIAKL-----DIN 302 G P QV L+W Q +A IPK+++ P L N LD++D A IA L ++ Sbjct: 206 GVLPTQVALKWLLDQPNVAAIPKASSEPNQLANLAALDVRLDDEDRALIASLSKRERQVS 265 Query: 303 LRFNDPWD 310 F WD Sbjct: 266 PDFAPVWD 273 Lambda K H 0.320 0.139 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 277 Length adjustment: 26 Effective length of query: 292 Effective length of database: 251 Effective search space: 73292 Effective search space used: 73292 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory