GapMind for catabolism of small carbon sources

 

Protein Pf1N1B4_3234 in Pseudomonas fluorescens FW300-N1B4

Annotation: Beta-ketoadipyl CoA thiolase (EC 2.3.1.-)

Length: 400 amino acids

Source: pseudo1_N1B4 in FitnessBrowser

Candidate for 22 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
4-hydroxybenzoate catabolism paaJ2 hi subunit of β-ketoadipyl CoA thiolase (EC 2.3.1.174; EC 2.3.1.16) (characterized) 89% 100% 704.1 acetyl-CoA C-acetyltransferase (EC 2.3.1.16) 47% 328.9
4-hydroxybenzoate catabolism paaJ2 med pcaF: 3-oxoadipyl-CoA thiolase (EC 2.3.1.174) (TIGR02430) 100% 737 acetyl-CoA C-acetyltransferase (EC 2.3.1.16) 47% 328.9
4-hydroxybenzoate catabolism pcaF hi subunit of β-ketoadipyl CoA thiolase (EC 2.3.1.174; EC 2.3.1.16) (characterized) 89% 100% 704.1 Beta-ketoadipyl CoA thiolase (EC 2.3.1.-) 66% 523.5
4-hydroxybenzoate catabolism pcaF med pcaF: 3-oxoadipyl-CoA thiolase (EC 2.3.1.174) (TIGR02430) 100% 737 Beta-ketoadipyl CoA thiolase (EC 2.3.1.-) 66% 523.5
phenylacetate catabolism paaJ2 hi subunit of β-ketoadipyl CoA thiolase (EC 2.3.1.174; EC 2.3.1.16) (characterized) 89% 100% 704.1 acetyl-CoA C-acetyltransferase (EC 2.3.1.16) 47% 328.9
phenylacetate catabolism paaJ2 med pcaF: 3-oxoadipyl-CoA thiolase (EC 2.3.1.174) (TIGR02430) 100% 737 acetyl-CoA C-acetyltransferase (EC 2.3.1.16) 47% 328.9
L-phenylalanine catabolism paaJ2 hi subunit of β-ketoadipyl CoA thiolase (EC 2.3.1.174; EC 2.3.1.16) (characterized) 89% 100% 704.1 acetyl-CoA C-acetyltransferase (EC 2.3.1.16) 47% 328.9
L-phenylalanine catabolism paaJ2 med pcaF: 3-oxoadipyl-CoA thiolase (EC 2.3.1.174) (TIGR02430) 100% 737 acetyl-CoA C-acetyltransferase (EC 2.3.1.16) 47% 328.9
L-tryptophan catabolism pcaF hi subunit of β-ketoadipyl CoA thiolase (EC 2.3.1.174; EC 2.3.1.16) (characterized) 89% 100% 704.1 Beta-ketoadipyl CoA thiolase (EC 2.3.1.-) 66% 523.5
L-tryptophan catabolism pcaF med pcaF: 3-oxoadipyl-CoA thiolase (EC 2.3.1.174) (TIGR02430) 100% 737 Beta-ketoadipyl CoA thiolase (EC 2.3.1.-) 66% 523.5
L-isoleucine catabolism fadA hi subunit of β-ketoadipyl CoA thiolase (EC 2.3.1.174; EC 2.3.1.16) (characterized) 89% 100% 704.1 Beta-ketoadipyl-CoA thiolase; 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 85% 673.3
L-isoleucine catabolism fadA med acetyl-CoA C-acyltransferase (EC 2.3.1.16) (TIGR01930) 100% 443.1 Beta-ketoadipyl-CoA thiolase; 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 85% 673.3
phenylacetate catabolism paaJ1 hi 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 (characterized, see rationale) 71% 100% 565.1 acetyl-CoA C-acetyltransferase (EC 2.3.1.16) 47% 328.9
L-phenylalanine catabolism paaJ1 hi 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 (characterized, see rationale) 71% 100% 565.1 acetyl-CoA C-acetyltransferase (EC 2.3.1.16) 47% 328.9
4-hydroxybenzoate catabolism atoB med acetyl-CoA C-acetyltransferase [EC: 2.3.1.9] (characterized) 47% 100% 328.2 Beta-ketoadipyl-CoA thiolase; 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 85% 673.3
L-arginine catabolism atoB med acetyl-CoA C-acetyltransferase [EC: 2.3.1.9] (characterized) 47% 100% 328.2 Beta-ketoadipyl-CoA thiolase; 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 85% 673.3
L-citrulline catabolism atoB med acetyl-CoA C-acetyltransferase [EC: 2.3.1.9] (characterized) 47% 100% 328.2 Beta-ketoadipyl-CoA thiolase; 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 85% 673.3
2-deoxy-D-ribonate catabolism atoB med acetyl-CoA C-acetyltransferase [EC: 2.3.1.9] (characterized) 47% 100% 328.2 Beta-ketoadipyl-CoA thiolase; 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 85% 673.3
2-deoxy-D-ribose catabolism atoB med acetyl-CoA C-acetyltransferase [EC: 2.3.1.9] (characterized) 47% 100% 328.2 Beta-ketoadipyl-CoA thiolase; 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 85% 673.3
L-leucine catabolism atoB med acetyl-CoA C-acetyltransferase [EC: 2.3.1.9] (characterized) 47% 100% 328.2 Beta-ketoadipyl-CoA thiolase; 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 85% 673.3
L-lysine catabolism atoB med acetyl-CoA C-acetyltransferase [EC: 2.3.1.9] (characterized) 47% 100% 328.2 Beta-ketoadipyl-CoA thiolase; 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 85% 673.3
phenylacetate catabolism atoB med acetyl-CoA C-acetyltransferase [EC: 2.3.1.9] (characterized) 47% 100% 328.2 Beta-ketoadipyl-CoA thiolase; 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 85% 673.3
L-phenylalanine catabolism atoB med acetyl-CoA C-acetyltransferase [EC: 2.3.1.9] (characterized) 47% 100% 328.2 Beta-ketoadipyl-CoA thiolase; 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 85% 673.3
L-proline catabolism atoB med acetyl-CoA C-acetyltransferase [EC: 2.3.1.9] (characterized) 47% 100% 328.2 Beta-ketoadipyl-CoA thiolase; 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 85% 673.3
L-tyrosine catabolism atoB med acetyl-CoA C-acetyltransferase [EC: 2.3.1.9] (characterized) 47% 100% 328.2 Beta-ketoadipyl-CoA thiolase; 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 85% 673.3
4-hydroxybenzoate catabolism pimB med 3-oxopimeloyl-CoA:CoA acetyltransferase (characterized) 41% 100% 249.6 subunit of β-ketoadipyl CoA thiolase (EC 2.3.1.174; EC 2.3.1.16) 89% 704.1
phenylacetate catabolism pimB med 3-oxopimeloyl-CoA:CoA acetyltransferase (characterized) 41% 100% 249.6 subunit of β-ketoadipyl CoA thiolase (EC 2.3.1.174; EC 2.3.1.16) 89% 704.1
L-phenylalanine catabolism pimB med 3-oxopimeloyl-CoA:CoA acetyltransferase (characterized) 41% 100% 249.6 subunit of β-ketoadipyl CoA thiolase (EC 2.3.1.174; EC 2.3.1.16) 89% 704.1

Sequence Analysis Tools

View Pf1N1B4_3234 at FitnessBrowser

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search PFam (including for weak hits, up to E = 1)

Predict protein localization: PSORTb (Gram negative bacteria)

Predict transmembrane helices: TMHMM

Check the SEED with FIGfam search

Fitness BLAST: loading...

Sequence

MRDVYICDAIRTPIGRFGGGLSAVRADDLAAVPIKALMARNPSVDWSAVDEVFLGCANQA
GEDNRNVARMALLLAGLPETIPGVTLNRLCASGMDAIGTAFRAIASGEMELAIAGGVESM
SRAPFVMGKADAAFSRNMKLEDTTIGWRFINPLMKAQYGVDAMPQTADNVADDYRISRAD
QDAFALRSQQRTAAAQAAGFFAEEIVEVRIAHKKGESVVTQDEHPRADTTLETLAKLKPV
NGPDKTVTAGNASGVNDGAAALILASAEAVKKHGLTARAKVLGMSSAGVAPRVMGIGPVP
AVRKLTERLGLAVSDFDVIELNEAFASQGLAVLRELGLADDSAQVNPNGGAIALGHPLGM
SGARLVLTALHQLEKTGGKKGLATMCVGVGQGLALAIERV

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory