Protein Pf1N1B4_4287 in Pseudomonas fluorescens FW300-N1B4
Annotation: Inositol transport system permease protein
Length: 340 amino acids
Source: pseudo1_N1B4 in FitnessBrowser
Candidate for 31 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
myo-inositol catabolism | PS417_11895 | hi | m-Inositol ABC transporter, permease component (iatP) (characterized) | 98% | 100% | 632.1 | Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR | 40% | 228.0 |
xylitol catabolism | PS417_12060 | med | ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale) | 45% | 100% | 267.3 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
D-cellobiose catabolism | mglC | med | Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) | 40% | 97% | 228 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
D-glucose catabolism | mglC | med | Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) | 40% | 97% | 228 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
lactose catabolism | mglC | med | Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) | 40% | 97% | 228 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
D-maltose catabolism | mglC | med | Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) | 40% | 97% | 228 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
sucrose catabolism | mglC | med | Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) | 40% | 97% | 228 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
trehalose catabolism | mglC | med | Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) | 40% | 97% | 228 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
D-xylose catabolism | xylH | med | Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) | 40% | 97% | 228 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
D-fructose catabolism | frcC | med | Ribose ABC transport system, permease protein RbsC (characterized, see rationale) | 43% | 87% | 216.9 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
sucrose catabolism | frcC | med | Ribose ABC transport system, permease protein RbsC (characterized, see rationale) | 43% | 87% | 216.9 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
D-mannose catabolism | HSERO_RS03645 | med | ABC-type sugar transport system, permease component protein (characterized, see rationale) | 41% | 95% | 215.3 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
D-ribose catabolism | rbsC | med | ABC transporter permease (characterized, see rationale) | 40% | 84% | 179.9 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
myo-inositol catabolism | iatP | lo | Inositol ABC transport system, permease protein IatP, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized) | 38% | 97% | 217.6 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
D-galactose catabolism | mglC | lo | MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) | 35% | 99% | 208.4 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
D-xylose catabolism | xylF_Tm | lo | ABC-type transporter, integral membrane subunit, component of Xylose porter (Nanavati et al. 2006). Regulated by xylose-responsive regulator XylR (characterized) | 38% | 99% | 202.6 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
L-fucose catabolism | HSERO_RS05255 | lo | ABC-type sugar transport system, permease component protein (characterized, see rationale) | 33% | 97% | 192.2 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
L-arabinose catabolism | araH | lo | L-arabinose ABC transporter, permease protein AraH (characterized) | 36% | 82% | 180.3 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
D-galactose catabolism | BPHYT_RS16925 | lo | Arabinose ABC transporter permease (characterized, see rationale) | 33% | 98% | 179.1 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
D-mannose catabolism | frcC | lo | Fructose import permease protein FrcC (characterized) | 33% | 89% | 176.8 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
D-ribose catabolism | frcC | lo | Fructose import permease protein FrcC (characterized) | 33% | 89% | 176.8 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
D-galactose catabolism | ytfT | lo | Galactofuranose transporter permease protein YtfT (characterized) | 33% | 95% | 174.9 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
L-arabinose catabolism | araZsh | lo | Inner-membrane translocator (characterized, see rationale) | 34% | 99% | 166.8 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
L-arabinose catabolism | araWsh | lo | Inner-membrane translocator (characterized, see rationale) | 34% | 77% | 164.9 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
L-rhamnose catabolism | rhaP | lo | RhaP, component of Rhamnose porter (Richardson et al., 2004) (Transport activity is dependent on rhamnokinase (RhaK; AAQ92412) activity (Richardson and Oresnik, 2007) This could be an example of group translocation!) (characterized) | 31% | 93% | 163.7 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
D-fructose catabolism | fruG | lo | Fructose import permease protein FruG (characterized) | 32% | 97% | 156.8 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
sucrose catabolism | fruG | lo | Fructose import permease protein FruG (characterized) | 32% | 97% | 156.8 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
D-fructose catabolism | fruF | lo | Fructose import permease protein FruF (characterized) | 32% | 82% | 150.2 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
sucrose catabolism | fruF | lo | Fructose import permease protein FruF (characterized) | 32% | 82% | 150.2 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
L-arabinose catabolism | xylHsa | lo | Xylose/arabinose import permease protein XylH (characterized, see rationale) | 30% | 88% | 139 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
D-galactose catabolism | yjtF | lo | Inner membrane ABC transporter permease protein YjfF (characterized) | 31% | 93% | 137.9 | m-Inositol ABC transporter, permease component (iatP) | 98% | 632.1 |
Sequence Analysis Tools
View Pf1N1B4_4287 at FitnessBrowser
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Search PFam (including for weak hits, up to E = 1)Predict protein localization: PSORTb (Gram negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the SEED with FIGfam search
Fitness BLAST: loading...
Sequence
MNAILENKPAAVPVKSRRRFPTELSIFLVLIGIGLVFEMFGWIVRDQSFLMNSQRLVLMI
LQVSIIGLLAIGVTQVIITTGIDLSSGSVLALSAMIAASLAQTSDFARAVFPSLTDLPVW
IPVIVGLGVGLLAGAINGSIIAITGIPPFIATLGMMVSARGLARYYTEGQPVSMLSDSYT
AIGHGAMPVIIFLVVAVIFHIALRYTKYGKYTYAIGGNMQAARTSGINVKRHLVIVYSIA
GLLAGLAGVVASARAATGQAGMGMSYELDAIAAAVIGGTSLAGGVGRITGTVIGALILGV
MASGFTFVGVDAYIQDIIKGLIIVVAVVIDQYRNKRKLKR
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory