GapMind for catabolism of small carbon sources

 

Protein Pf1N1B4_593 in Pseudomonas fluorescens FW300-N1B4

Annotation: Glucose ABC transporter, ATP-binding subunit (EC 3.6.3.-)

Length: 386 amino acids

Source: pseudo1_N1B4 in FitnessBrowser

Candidate for 43 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-cellobiose catabolism gtsD hi ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 96% 100% 734.9 MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins 50% 355.1
D-galactose catabolism PfGW456L13_1897 hi ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 96% 100% 734.9 MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins 50% 355.1
D-glucose catabolism gtsD hi ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 96% 100% 734.9 MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins 50% 355.1
lactose catabolism gtsD hi ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 96% 100% 734.9 MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins 50% 355.1
D-maltose catabolism gtsD hi ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 96% 100% 734.9 MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins 50% 355.1
sucrose catabolism gtsD hi ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 96% 100% 734.9 MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins 50% 355.1
trehalose catabolism gtsD hi ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 96% 100% 734.9 MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins 50% 355.1
D-xylose catabolism gtsD med ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 88% 100% 670.2 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
D-glucosamine (chitosamine) catabolism SM_b21216 med ABC transporter for D-Glucosamine, ATPase component (characterized) 51% 99% 355.1 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
D-maltose catabolism malK1 med MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 50% 99% 355.1 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
trehalose catabolism thuK med MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 50% 99% 355.1 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
D-maltose catabolism malK_Aa med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 47% 100% 341.7 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
D-cellobiose catabolism SMc04256 med ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 48% 100% 337 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
D-maltose catabolism thuK med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 48% 98% 334.3 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
D-mannose catabolism TT_C0211 med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 48% 98% 334.3 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
sucrose catabolism thuK med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 48% 98% 334.3 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
xylitol catabolism HSERO_RS17020 med ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 47% 90% 328.6 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
L-fucose catabolism SM_b21106 med ABC transporter for L-Fucose, ATPase component (characterized) 47% 100% 326.6 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
D-mannitol catabolism mtlK med ABC transporter for D-Mannitol, D-Mannose, and D-Mannose, ATPase component (characterized) 48% 96% 323.6 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
lactose catabolism lacK med ABC transporter for Lactose, ATPase component (characterized) 48% 99% 321.2 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
D-maltose catabolism malK_Sm med MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 45% 100% 315.5 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
trehalose catabolism malK med MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 45% 100% 315.5 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
D-maltose catabolism malK_Bb med ABC-type maltose transport, ATP binding protein (characterized, see rationale) 46% 100% 314.3 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
D-sorbitol (glucitol) catabolism mtlK med MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized) 47% 96% 313.5 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
L-arabinose catabolism xacK med Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 47% 100% 312 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
D-cellobiose catabolism msiK med MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 46% 100% 311.2 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
D-maltose catabolism musK med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 44% 100% 305.8 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
D-maltose catabolism malK med Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 46% 96% 298.1 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 47% 82% 293.9 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 47% 82% 293.9 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
D-maltose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 43% 98% 283.9 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
sucrose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 43% 98% 283.9 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
trehalose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 43% 98% 283.9 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
L-arabinose catabolism xacJ med Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 44% 95% 283.5 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
D-cellobiose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 45% 97% 279.6 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
D-glucose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 45% 97% 279.6 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
lactose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 45% 97% 279.6 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
D-maltose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 45% 97% 279.6 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
sucrose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 45% 97% 279.6 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
trehalose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 45% 97% 279.6 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
xylitol catabolism Dshi_0546 med ABC transporter for Xylitol, ATPase component (characterized) 55% 71% 276.6 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 44% 92% 251.1 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9
glycerol catabolism glpT lo GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 37% 97% 217.6 ABC transporter for D-Galactose and D-Glucose, ATPase component 96% 734.9

Sequence Analysis Tools

View Pf1N1B4_593 at FitnessBrowser

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search PFam (including for weak hits, up to E = 1)

Predict protein localization: PSORTb (Gram negative bacteria)

Predict transmembrane helices: TMHMM

Check the SEED with FIGfam search

Fitness BLAST: loading...

Sequence

MATLELRNVNKTYGAGLPDTLKNIELKINDGEFLILVGPSGCGKSTLMNCIAGLENISGG
AILVDDADISGMSPKDRDIAMVFQSYALYPTMSVRDNIAFGLKIRKMPTAEIDEEVARVA
KLLQIEHLLSRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKL
MHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKDIYNNPANLFVASFIGSPP
MNFIPLRLQRKDGRLVALLDSGQARCELPLGMQDAGLEDREVILGMRPEQIVLAGSEPNG
LPTIRAEVQVTEPTGPDTLVFVNLNDTKVCCRLAPDVAPAVGETLTLQFDPSKVLLFDAK
TGERLGVAGLPKTEAHSANVAQFKGR

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory