Align alpha-ketoglutarate permease (MHS family) (characterized)
to candidate Pf1N1B4_180 L-Proline/Glycine betaine transporter ProP
Query= reanno::pseudo5_N2C3_1:AO356_17790 (439 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_180 Length = 459 Score = 196 bits (499), Expect = 1e-54 Identities = 132/436 (30%), Positives = 209/436 (47%), Gaps = 11/436 (2%) Query: 4 SNALPIGSAAVPARERTTASRIKSIFSGSVGNMVEWYDWYVYA-AFSLYFAKVFFPKGDT 62 S+ P+ + P S K + +G VEWYD +V+A A +L F KVFFP D Sbjct: 2 SDLSPVEKSGAPPE--VAISMKKVAVASVIGTTVEWYDLFVFATASALVFNKVFFPDFDP 59 Query: 63 TAQLLNTAAIFAVGFLMRPIGGWLMGLYADRAGRKRALMASVYLMCFGSLIIALSPSYET 122 L FA +L R +G L G + DR GRK L+ S+ M + I L P+Y Sbjct: 60 LIGTLLAFGTFASAYLARIVGAALFGHFGDRLGRKSMLLVSLLTMGAATFAIGLLPNYAA 119 Query: 123 IGVGAPILLVFARLLQGLSVGGEYGTSATYLSEMATKERRGFFSSFQYVTLISGQLIALG 182 IG+ APILL+ R++QGL++GGE+G + E A +RG + S+ + + +G +IA Sbjct: 120 IGIWAPILLLLLRVIQGLALGGEWGGAVLMAVEHAPANKRGLYGSWVQIGVPAGTMIANL 179 Query: 183 VLIVLQQFLTTEQLYAWGWRIPFAIGALCAVVALYLRRGMEETESFTKKEKSKESAMRTL 242 +V+ +L+ E L AWGWRIPF L V LY+R + ET +F K ++++ L Sbjct: 180 AFLVIAAWLSPEDLLAWGWRIPFLASVLLIAVGLYIRLNISETPAFNKVKEAEVQVKMPL 239 Query: 243 L----RHPKELMTVVGLTMGGTLAFYTYTTYMQKYLVNTVGMSISDSTTISAATLFLFMC 298 ++ K+++ TM +F + Y +G S S + + + Sbjct: 240 AEVFRKYWKQVVLGGIATMSTGASFNIIVAFGLTYGTQNLGFSRSVMLGVVLLSCAWCIV 299 Query: 299 LQPVIGGLSDKIGRRPILIAFGILGTLFTVPILTTLHTIQTWWGAFFLIMAALIIVSGYT 358 + PV G LSD+ GR+PI++A + L P+ + T + F ++ + Y Sbjct: 300 MLPVFGALSDRYGRKPIIVAGIVAEALVAFPMFWLMDTKELSLVIFGYLLLMTAFAANYG 359 Query: 359 SINAVVKAELFPTEIRALGVGLPYALTVSIFGGTAEYI--ALWFKSIGMETGYYWYVTAC 416 I A AELF T +R G+ + Y L+ + G A I + G + WY+ Sbjct: 360 PI-ATFLAELFGTRVRYSGLSISYMLS-GLLGSAATPIVTTALLAATGKGSSVAWYMIGA 417 Query: 417 IAVSLLVYITMKDTRK 432 +SL+ + + +T K Sbjct: 418 AFISLVALLLLTETFK 433 Lambda K H 0.326 0.138 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 570 Number of extensions: 30 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 439 Length of database: 459 Length adjustment: 33 Effective length of query: 406 Effective length of database: 426 Effective search space: 172956 Effective search space used: 172956 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory