Align Benzoate--CoA ligase; Benzoyl-CoA synthetase; EC 6.2.1.25 (characterized)
to candidate Pf1N1B4_4784 Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases
Query= SwissProt::Q8GQN9 (527 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4784 Length = 554 Score = 197 bits (501), Expect = 8e-55 Identities = 162/517 (31%), Positives = 244/517 (47%), Gaps = 20/517 (3%) Query: 23 NAADDLIGRNLLAGRGGKTVYIDDAGS--YTYDELALRVNRCGSALRTTLGLQPKDRVLV 80 NA + R+ L GR D S YT+ +L + R + L G++ D+V Sbjct: 29 NACVECCDRHALPGRIALFWEGRDGASATYTFSDLQDKAARFANFLLAQ-GVKKGDKVAG 87 Query: 81 CVLDGIDFPTTFLGAIKGGVVPIAINTLLTESDYEYMLTDSAARVAVVSQELLPLFAPML 140 + I+ T + G V + T E+ L S A V V + P L Sbjct: 88 LLPRNIELLITVFATWRIGAVYQPLFTAFGPKAIEHRLNSSGAAVVVTDA----VNRPKL 143 Query: 141 GKVPTLEHLVVAGGA-------GEDSLAALLATGSEQFEAAPTRPDDHCFWLYSSGSTGA 193 +V +V GG G+ S A LA S + E +D +++SG+TG Sbjct: 144 AEVADCPTIVTVGGPKGQGIVRGDFSFWAELANYSSECEPVLLTGEDPFLLMFTSGTTG- 202 Query: 194 PKGTVHIHSDLIHTAELYARPILGIREGDVVFSAAKLFFAYGLGNGLIFPLAVGATAVLM 253 P + + I + Y R + +R D ++ A +AYG+ G+ P+A+G Sbjct: 203 PSKALSVPLKAIVAFQSYTRDAVDLRPEDAFWNVADPGWAYGIYFGVTGPMAMGHPITFY 262 Query: 254 AERPTPAAVFERLRRHQPDIFYGVPTLYASMLANPD-CPKEGELRLRACTSAGEALPEDV 312 T + + ++ G PT Y ++A D + + +LR +SAGE L +V Sbjct: 263 DGPFTLESTCRVINKYGITNLTGSPTAYRLLIAGGDEFARSIKGKLRIVSSAGEPLNPEV 322 Query: 313 GRRWQARFGVDILDGIGSTEMLHIFLSNRAGD--VHYGTSGKPVPGYRLRLIDEDGAEIT 370 R + GV I D G TE+ + ++ D VH G +G PG+R+ ++D++ E+ Sbjct: 323 IRWFADNLGVVIHDHYGQTELGMVLCNHHGLDHPVHVGAAGFASPGHRIVVLDDEYKELG 382 Query: 371 TAGVAGELQISGPSSAVMYWNNPEKTAA-TFMGEWTRSGDKYLVNDEGYYVYAGRSDDML 429 G G L I S + ++ E F+G + SGD N +G + GRSDD++ Sbjct: 383 V-GQPGILAIDRTQSPMCWFGGYEGAPTKAFVGNYYLSGDTVEWNPDGSISFVGRSDDVI 441 Query: 430 KVSGIYVSPIEVESALIAHEAVLEAAVVGWEDEDHLIKPKAFIVLKPGYGAGEALRTDLK 489 SG V P +VESALI H AV+EAAV+G D + KAF+VL P Y A AL +L+ Sbjct: 442 TTSGYRVGPFDVESALIEHPAVVEAAVIGKPDPERTELVKAFVVLSPQYRAEPALAEELR 501 Query: 490 AHVKNLLAPYKYPRWIEFVDDLPKTATGKIQRFKLRS 526 HV+ LA + YPR IEFV +LPKT +GK+QRF LR+ Sbjct: 502 QHVRKRLAAHAYPREIEFVSELPKTPSGKLQRFILRN 538 Lambda K H 0.319 0.138 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 787 Number of extensions: 40 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 527 Length of database: 554 Length adjustment: 35 Effective length of query: 492 Effective length of database: 519 Effective search space: 255348 Effective search space used: 255348 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory