Align protocatechuate 4,5-dioxygenase β subunit (EC 1.13.11.8; EC 1.13.11.57) (characterized)
to candidate Pf1N1B4_4199 Protocatechuate 4,5-dioxygenase beta chain (EC 1.13.11.8)
Query= metacyc::MONOMER-3166 (289 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4199 Length = 420 Score = 259 bits (662), Expect = 7e-74 Identities = 123/289 (42%), Positives = 179/289 (61%), Gaps = 11/289 (3%) Query: 1 MARITASVFTSHVPAIGAAMDMGKTQEAYWAPLFKGYDFSRQWMKDNKPDVIFLVYNDHA 60 MARI + SH P IG A+D K EA WAP+F+G++ + W+K+ KPDV+F ++NDH Sbjct: 1 MARIIGGLAVSHTPTIGFAVDHDKQHEAAWAPIFRGFEPIKVWLKEQKPDVLFYIFNDHV 60 Query: 61 TAFSLDCIPTFAIGTAAEFQPADEGWGPRPVPKVVGHPDLASHIAQSVIQQDFDLTIVNK 120 T+F D F++G ++ ADEG PR +P + GH L+ HI +S++ +FD++ Sbjct: 61 TSFFFDHYGAFSLGVDERYEVADEGGNPRELPGIGGHAALSRHIGESLVADEFDMSFFRD 120 Query: 121 MDVDHGLTVPLSLMCGEQDPKTGSWPCPVIPFAVNVVQYPVPTGQRCFNLGRAIRKAVES 180 +DHG P+S + P WP ++P V V+Q+PVP+ +RC+ LG+A+R+A+ES Sbjct: 121 KPLDHGFFSPMSALL----PCEPDWPVEIVPLQVGVLQFPVPSARRCYKLGQALRRAIES 176 Query: 181 YDQDINVHIWGTGGMSHQLQGARAGLINKEWDNQFLDLLVENPHGLAQMPHIDYVREAGS 240 Y +D+ V I TGG+SHQ+ G R G N EWD QF+DLLV +P L +M H +Y G Sbjct: 177 YPEDLKVAIVATGGVSHQVHGERCGFNNPEWDQQFIDLLVNDPERLTEMTHAEYAALGGM 236 Query: 241 EGIELVMWLIARGAMSDVDGPAPLPKVAHRFYHVPASNTAVGHLILENQ 289 EG E++ WLI RGA+S K H+ Y++P S T + L+LENQ Sbjct: 237 EGSEVITWLIMRGALS------ATVKNLHQDYYLP-SMTGIATLLLENQ 278 Lambda K H 0.321 0.137 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 420 Length adjustment: 29 Effective length of query: 260 Effective length of database: 391 Effective search space: 101660 Effective search space used: 101660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory