Align 4-oxalmesaconate hydratase; OMA hydratase; Gallate degradation protein B; EC 4.2.1.83 (characterized)
to candidate Pf1N1B4_4202 4-oxalmesaconate hydratase (EC 4.2.1.83)
Query= SwissProt::Q88JX8 (258 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4202 Length = 244 Score = 449 bits (1155), Expect = e-131 Identities = 215/239 (89%), Positives = 228/239 (95%) Query: 20 KSALVVSAHSADFVWRAGGAIALHAEQGYAMHVVCLSFGERGESAKLWRKGEMTEAKVKD 79 K+ALVVSAHSADFVWRAGGAIALHA+QGY +H+VCLSFGERGESAKLWRKGEM+E KVK Sbjct: 6 KNALVVSAHSADFVWRAGGAIALHAQQGYNVHIVCLSFGERGESAKLWRKGEMSEDKVKA 65 Query: 80 ARREEAMAAAEILGASVEFFDIGDYPMRADKDTLFRLADVYRRVQPEFVLSHSLKDPYNY 139 ARREEA AAA+ILGASVEFFDIGDYPMRADK+TL+RLADV+RRVQPEFVLSHSLKDPYN+ Sbjct: 66 ARREEAQAAADILGASVEFFDIGDYPMRADKETLYRLADVFRRVQPEFVLSHSLKDPYNF 125 Query: 140 DHPLAMHLAQEARIIAQAEGYKPGEKIVGAPPVYAFEPHQPEQCEWRPDTFLDITSVWDK 199 DHPLAM+L QEARIIAQAEGYKPGEKIVGAPPVY+FEPHQPEQCEWRPD LDIT VWDK Sbjct: 126 DHPLAMNLTQEARIIAQAEGYKPGEKIVGAPPVYSFEPHQPEQCEWRPDVLLDITDVWDK 185 Query: 200 KYAAIQCMAGQEHLWEYYTRVALQRGVQAKRNVGITSARNIVYAEGLQSVFPRVTENLA 258 KYAAIQCMAGQEHLWEYYTRVALQRGVQAKRNVGITS RNIVY EG QS+FPRVTENLA Sbjct: 186 KYAAIQCMAGQEHLWEYYTRVALQRGVQAKRNVGITSTRNIVYGEGYQSIFPRVTENLA 244 Lambda K H 0.320 0.132 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 343 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 244 Length adjustment: 24 Effective length of query: 234 Effective length of database: 220 Effective search space: 51480 Effective search space used: 51480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory