Align lactate dehydrogenase (NAD+, ferredoxin) (subunit 1/3) (EC 1.3.1.110) (characterized)
to candidate Pf1N1B4_2274 D-2-hydroxyglutarate dehydrogenase
Query= BRENDA::H6LBS1 (466 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2274 Length = 464 Score = 213 bits (543), Expect = 8e-60 Identities = 139/462 (30%), Positives = 234/462 (50%), Gaps = 16/462 (3%) Query: 11 IAAIKELIPAERVFVGTEIGEDFSHDELGSIHSYPEVLIKVTSTEEVSKIMKYAYEHNIP 70 I +K L+ +V + + D P ++ +TE+V I+++A EH + Sbjct: 7 IDELKTLVEPGKVLTDADSLNAYGKDWTKHFAPAPTAIVFPKTTEQVQAIVRWANEHKVA 66 Query: 71 VVVRGSGTGLVGACVPLFGGIMLETTLMNNILELDTENLTVTVEPGVLLMELSKFVEEND 130 +V G TGL A V G +++ MN IL+++ + T +PGV+ +L EE+ Sbjct: 67 LVPSGGRTGLSAAAVAANGEVVVSFDYMNQILDVNLTDRTAVCQPGVVTEQLQNKAEEHG 126 Query: 131 LFYPPD-PGEKSATIAGNISTNAGGMRAVKYGVTRDYVRGLTVVLANGEIIELGGKIVKN 189 L+YP D S+ I GNI TNAGG++ ++YG+TR++V G+ VV G+++EL ++KN Sbjct: 127 LYYPVDFASAGSSQIGGNIGTNAGGIKVIRYGMTRNWVAGMKVVTGKGDLLELNKDLIKN 186 Query: 190 SSGYSLKDLVIGSEGTLCVITKAILKLLPLPKMTLSLLIPFENISDAAGIVPKI--IKSK 247 ++GY L+ L IG+EGTL + +A ++L PK ++++ +D I+P + +SK Sbjct: 187 ATGYDLRQLFIGAEGTLGFVVEATMRLDRAPKNLTAMVL---GTADFDSIMPVLHAFQSK 243 Query: 248 AIPTAIEFMERQTI--LFAEDFLGKKFPDSSSNAYILLTFDGNTKEQVEAEYETVANLCL 305 TA EF + + + A + F +S Y LL F+ T+E ET + C+ Sbjct: 244 LDLTAFEFFSDKALAKVMARGDVPAPF-ESDCPFYALLEFEATTEEVANHALETFEH-CV 301 Query: 306 AEG-AKDVYIVDTVERKDSVWSARGAFLEAIKASTTEMDECDVVVPRNRIAEFIEFTHDL 364 +G D + + + ++W R E I T ++ V V +++ F++ + Sbjct: 302 EQGWVLDGVMSQSETQLQNLWKLREYISETISHWTPYKNDISVTV--SKVPAFLKEIDAI 359 Query: 365 AKE--MDVRIPSFGHAGDGNLHIYVCR-DELCQADWEAKLAEAMDRMYAKALTFEGLVSG 421 E D I FGH GDGNLH+ + + D L + ++ AK A ++ + G +S Sbjct: 360 VGEHYPDFEIVWFGHIGDGNLHLNILKPDNLSKDEFFAKCATVNKWVFETVEKYNGSISA 419 Query: 422 EHGIGYAKRKYLLNDFGTEHLALMAGIKQTFDPKNLLNPKKV 463 EHG+G KR YL + M +K FDP ++NP K+ Sbjct: 420 EHGVGMTKRDYLTYSRSPVEIEYMKAVKAVFDPNGIMNPGKI 461 Lambda K H 0.318 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 528 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 466 Length of database: 464 Length adjustment: 33 Effective length of query: 433 Effective length of database: 431 Effective search space: 186623 Effective search space used: 186623 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory