GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lctP in Pseudomonas fluorescens FW300-N1B4

Align L-lactate and D-lactate permease (lctP family) (characterized)
to candidate Pf1N1B4_1186 L-lactate permease

Query= reanno::pseudo5_N2C3_1:AO356_07550
         (564 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1186 L-lactate permease
          Length = 563

 Score = 1055 bits (2727), Expect = 0.0
 Identities = 540/564 (95%), Positives = 549/564 (97%), Gaps = 1/564 (0%)

Query: 1   MQTWQQLYSPLGSLGLSALAAVIPIVFFFLALAVFRLKGHVAGSITLALAIAVAIFAFNM 60
           MQTWQQLYSPLGSLG+SALAAVIPIVFFFLALAVFRLKGHVAGSITLAL+IAVAIFAF M
Sbjct: 1   MQTWQQLYSPLGSLGVSALAAVIPIVFFFLALAVFRLKGHVAGSITLALSIAVAIFAFQM 60

Query: 61  PADMAFAAAGYGFAYGLWPIAWIIVAAVFLYKLTVKSGQFEVIRSSVLSITDDQRLQVLL 120
           P DMAFAAAGYGFAYGLWPIAWIIVAAVFLYKLTVKSGQFEVIRSSVLSITDDQRLQVLL
Sbjct: 61  PVDMAFAAAGYGFAYGLWPIAWIIVAAVFLYKLTVKSGQFEVIRSSVLSITDDQRLQVLL 120

Query: 121 IGFCFGAFLEGAAGFGAPVAITAALLVGLGFNPLYAAGLCLIANTAPVAFGALGIPIIVA 180
           IGFCFGAFLEGAAGFGAPVAITAALLVGLGFNPLYAAGLCLIANTAPVAFGALGIPIIVA
Sbjct: 121 IGFCFGAFLEGAAGFGAPVAITAALLVGLGFNPLYAAGLCLIANTAPVAFGALGIPIIVA 180

Query: 181 GQVTGIDAFKIGAMTGRQLPLLSLFVPFWLVFMMDGLRGVRETWPAALVAGLSFAITQYF 240
           GQVTGIDAFKIGAMTGRQLPLLSLFVPFWLVFMMDGLRGVRETWPAALVAGLSFAITQYF
Sbjct: 181 GQVTGIDAFKIGAMTGRQLPLLSLFVPFWLVFMMDGLRGVRETWPAALVAGLSFAITQYF 240

Query: 241 TSNFIGPELPDITSALASLISLTLFLKVWQPKRTAGAQIAGATSSATVTASVGGFGQPRS 300
           TSNFIGPELPDITSALASLISLTLFLK+WQPKR AG  I GA  SA+V +S GGFGQPR+
Sbjct: 241 TSNFIGPELPDITSALASLISLTLFLKIWQPKRAAGQHIVGAV-SASVVSSAGGFGQPRT 299

Query: 301 TVASPYSLGEIIKAWSPFLILTVLVTIWTLKPFKAMFAAGGSMYGWVFNFAIPHLDQMVI 360
           TVASPYSLGEI KAWSPFLILTVLVTIWTLKPFKAMFAAGGSMY WVFNFAIPHLDQMVI
Sbjct: 300 TVASPYSLGEIFKAWSPFLILTVLVTIWTLKPFKAMFAAGGSMYSWVFNFAIPHLDQMVI 359

Query: 361 KVAPIVINPTAIPAVFKLDPISATGTAIFFSALISMLVLKINIKTGLTTFKETLFELRWP 420
           KVAPIV  PTAIPAVFKLDPISATGTAIFFSALISMLVLKIN+K GLTTFKET++ELRWP
Sbjct: 360 KVAPIVTAPTAIPAVFKLDPISATGTAIFFSALISMLVLKINLKIGLTTFKETVYELRWP 419

Query: 421 ILSIGMVLAFAFVTNYSGMSSTMALVLAGTGAAFPFFSPFLGWLGVFLTGSDTSSNALFS 480
           ILSIGMVLAFAFVTNYSGMSSTMALVLAGTGAAFPFFSPFLGWLGVFLTGSDTSSNALFS
Sbjct: 420 ILSIGMVLAFAFVTNYSGMSSTMALVLAGTGAAFPFFSPFLGWLGVFLTGSDTSSNALFS 479

Query: 481 SLQATTAHQIGVNDTLLVAANTSGGVTGKMISPQSIAVACAATGLVGKESDLFRFTLKHS 540
           SLQATTAHQIGVNDTLLVAANTSGGVTGKMISPQSIAVACAATGLVGKESDLFRFTLKHS
Sbjct: 480 SLQATTAHQIGVNDTLLVAANTSGGVTGKMISPQSIAVACAATGLVGKESDLFRFTLKHS 539

Query: 541 LFFATIVGLITLAQAYWFTGMLVH 564
           LFFATIVGLITLAQAYWFTGMLVH
Sbjct: 540 LFFATIVGLITLAQAYWFTGMLVH 563


Lambda     K      H
   0.327    0.139    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1134
Number of extensions: 38
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 564
Length of database: 563
Length adjustment: 36
Effective length of query: 528
Effective length of database: 527
Effective search space:   278256
Effective search space used:   278256
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory