GapMind for catabolism of small carbon sources

 

Aligments for a candidate for cycA in Pseudomonas fluorescens FW300-N1B4

Align D-serine/D-alanine/glycine transporter (characterized)
to candidate Pf1N1B4_3559 Aromatic amino acid transport protein AroP

Query= SwissProt::P0AAE0
         (470 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3559 Aromatic amino acid
           transport protein AroP
          Length = 473

 Score =  344 bits (882), Expect = 4e-99
 Identities = 178/460 (38%), Positives = 278/460 (60%), Gaps = 19/460 (4%)

Query: 19  LRRNLTNRHIQLIAIGGAIGTGLFMGSGKTISLAGPSIIFVYMIIGFMLFFVMRAMGELL 78
           L+R L NRHIQLIA+GGAIGTGLF+GS   +  AGPS+I  Y I GF+ F +MR +GE++
Sbjct: 11  LKRGLKNRHIQLIALGGAIGTGLFLGSAGVLKSAGPSMILGYAICGFIAFMIMRQLGEMI 70

Query: 79  LSNLEYKSFSDFASDLLGPWAGYFTGWTYWFCWVVTGMADVVAITAYAQFWFPDLSDWVA 138
           +      SFS FA    G +AG+ +GW  W  +++ GM+++ A+  Y  +W PD+  WV+
Sbjct: 71  VEEPVAGSFSHFAHKYWGGFAGFLSGWNCWILYILVGMSELTAVGKYIHYWAPDIPTWVS 130

Query: 139 SLAVIVLLLTLNLATVKMFGEMEFWFAMIKIVAIVSLIVVGLVMVAMHFQSPTGVEASFA 198
           +    VL+  +NLA VK+FGE EFWFA+IK+VAIV +I +G  ++        G +AS  
Sbjct: 131 AAGFFVLINLINLANVKVFGEAEFWFAIIKVVAIVGMIALGSYLLV---SGDGGPQASVT 187

Query: 199 HLWNDGGWFPKGLSGFFAGFQIAVFAFVGIELVGTTAAETKDPEKSLPRAINSIPIRIIM 258
           +LW  GG+FP G+SG      I +F+F G+E++G TAAE   P+  +P+AIN +  RI++
Sbjct: 188 NLWEHGGFFPNGVSGLVMAMAIIMFSFGGLEMLGFTAAEADKPKTVIPKAINQVIYRILI 247

Query: 259 FYVFALIVIMSVTPWSSVVP---------EKSPFVELFVLVGLPAAASVINFVVLTSAAS 309
           FY+ AL+V++S+TPW S++            SPFV++F ++G   AA ++NFVVLT+A S
Sbjct: 248 FYIGALVVLLSLTPWDSLLTTLNASGDAYSGSPFVQVFSMLGSDTAAHILNFVVLTAALS 307

Query: 310 SANSGVFSTSRMLFGLAQEGVAPKAFAKLSKRAVPAKGLTFSCICLLGGVVMLYVNPSVI 369
             NSG +  SRML G+A++G APKA +K+ KR VP + +  S    L  V++ Y+ P   
Sbjct: 308 VYNSGTYCNSRMLLGMAEQGDAPKALSKIDKRGVPVRSILASAAVTLVAVLLNYLVPQ-- 365

Query: 370 GAFTMITTVSAILFMFVWTIILCSYLVYRKQRPHLHEKSIYKMPLGKLMCWVCMAFFVFV 429
            A  ++ ++     +  W +I  S+  +R+      +  ++K        +VC+AF VF+
Sbjct: 366 HALELLMSLVVATLVINWAMISFSHFKFRQHMNKTKQTPLFKALWYPYGNYVCLAFVVFI 425

Query: 430 VVLLTLEDDTRQALLVTPLWFIALGLGWLFIG--KKRAAE 467
           + ++ L    + ++   P+W   +   W+  G   KR+A+
Sbjct: 426 LGVMLLIPGIQISVYAIPVW---VAFMWVCYGIKNKRSAQ 462


Lambda     K      H
   0.329    0.141    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 596
Number of extensions: 34
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 470
Length of database: 473
Length adjustment: 33
Effective length of query: 437
Effective length of database: 440
Effective search space:   192280
Effective search space used:   192280
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory