GapMind for catabolism of small carbon sources

 

Aligments for a candidate for dctA in Pseudomonas fluorescens FW300-N1B4

Align sodium:C4-dicarboxylate symporter (dctA) (characterized)
to candidate Pf1N1B4_4413 Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate

Query= reanno::pseudo5_N2C3_1:AO356_18980
         (450 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4413 Aerobic
           C4-dicarboxylate transporter for fumarate, L-malate,
           D-malate, succunate
          Length = 451

 Score =  493 bits (1269), Expect = e-144
 Identities = 242/440 (55%), Positives = 331/440 (75%), Gaps = 6/440 (1%)

Query: 7   LYKSLYFQVIVAIAIGILLGHFYPQTGVALKPFGDGFIKLIKMVIAPIIFCTVVSGIGGM 66
           ++  LY QV++A+ +G ++G F P+TG ALKP GD FIKLIKM++AP+IF TVV+GI  M
Sbjct: 4   IFGKLYVQVLIAVILGAIVGVFVPETGTALKPLGDAFIKLIKMLLAPVIFLTVVTGIARM 63

Query: 67  QNMKSVGKTGGYALLYFEIVSTIALLIGLVVVNVVQPGAGMHIDVSTLDTSKIAGFISAG 126
           +NMK +G+ G  AL+YFE+VST+AL++GLVVV+V +PGAGM+IDV++LDTS +A + +A 
Sbjct: 64  ENMKELGRVGFRALIYFEVVSTLALVVGLVVVDVFKPGAGMNIDVASLDTSSLATYTTAV 123

Query: 127 KDQSIIAFILNVIPNTIVGAFANGDILQVLMFSVLFGFALHRLGAYGKPVLDFIDRFAHV 186
           K  S + F++N+IP+TIV AFA G++LQ+L+FS+L G AL  +G   K  +D +D     
Sbjct: 124 KHASFMDFVMNIIPDTIVDAFAKGNVLQILLFSILLGVALAHVGPRAKVFVDTLDSLMQG 183

Query: 187 MFIIINMIMKLAPLGAFGAMAFTIGAYGVGSLVQLGQLMICFYITCVVFVLVVLGAICRA 246
           MF I+NM+M+LAP+GAFGA+AFTIG YG GSL  LG+LM C Y+TC VFV+ VLG ICR 
Sbjct: 184 MFRIVNMVMRLAPIGAFGAIAFTIGKYGFGSLFSLGKLMACVYLTCAVFVIFVLGPICRY 243

Query: 247 HGFSVIKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYSFNLDG 306
            GFS+ K +++I+EEL  VLGTSSSES LP+M+ KME+ G  K V G++IP+G +FN DG
Sbjct: 244 SGFSLWKFLKFIKEELFTVLGTSSSESVLPQMISKMEKAGVSKPVAGMIIPSGLTFNPDG 303

Query: 307 TSIYLTMAAVFIAQATDTPMDLTHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSAVGHL 366
            +IY T+AA+FIAQAT+TP+ LT Q+ +L VL+ +SKG+AGVTGSGFI+LAATLS++G +
Sbjct: 304 QAIYYTIAAIFIAQATNTPLTLTDQLIVLAVLMFTSKGSAGVTGSGFIILAATLSSLGTI 363

Query: 367 PVAGLALILGIDRFMSEARALTNLVGNAVATIVVAKWVKELDEDQLQTELASGGRGISDV 426
           PVAG+ L+LG+DRFMSEARA+TN +GN V T+ +AKWV  LD  ++   L        + 
Sbjct: 364 PVAGMVLLLGVDRFMSEARAITNTIGNGVGTMAIAKWVGALDTVKMHKALN------GEA 417

Query: 427 REDDEQIAAAQIAAAETSAP 446
            E   +   A I A  ++ P
Sbjct: 418 AEQKPETVQADIVAVPSAMP 437


Lambda     K      H
   0.326    0.142    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 625
Number of extensions: 18
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 450
Length of database: 451
Length adjustment: 33
Effective length of query: 417
Effective length of database: 418
Effective search space:   174306
Effective search space used:   174306
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory