Align neutral amino acid transporter B(0) (characterized)
to candidate Pf1N1B4_3487 Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate, aspartate
Query= CharProtDB::CH_091706 (553 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3487 Length = 444 Score = 149 bits (375), Expect = 3e-40 Identities = 116/434 (26%), Positives = 206/434 (47%), Gaps = 72/434 (16%) Query: 92 GELLLRLLKMIILPLVVCSLIGGAASL-DPSALGRVGAWALLFFLVTTLLASALGVGLAL 150 G+ ++L+KM+I P++ C+++ G A + + ++G+ G +ALL+F + + +A +G+ + Sbjct: 40 GDGFIKLIKMVIAPIIFCTVVSGIAGMQNMKSVGKTGGYALLYFEIVSTIALLIGLVVVN 99 Query: 151 ALKPGAAVTA-ITSINDSVVDPCARSAPTKEALDSFLDLVRNIFPSNLVSAAFRSFATSY 209 ++PGA + +T+++ S + + + S + + N+ P+ +V A FA Sbjct: 100 VVQPGAGMHIDVTTLDTSKIAGFISAGKDQ----SIIGFILNVIPNTIVGA----FANG- 150 Query: 210 EPKDNSCKIPQSCIQREINSTMVQLLCEVEGMNILGLVVFAIVFGVALRKLGPEGELLIR 269 +IL +++F+++FG AL +LG G+ ++ Sbjct: 151 --------------------------------DILQVLMFSVIFGFALHRLGAYGKPVLD 178 Query: 270 FFNSFNDATMVLVSWIMWYAPVGILFLVASKIV-----EMKDVRQLFISLGKYILCCLLG 324 F + F +++ IM APVG +A I + + QL I YI C L Sbjct: 179 FIDRFAHVMFNIINMIMKLAPVGAFGAMAFTIGAYGVGSLVQLGQLMICF--YITCILFV 236 Query: 325 HAI-------HGLLVLPLIYFLFTRKNPYRFLWGIMTPLATAFGTSSSSATLPLMMKCVE 377 + HG V+ LI + I L GTSSS + LP M+ +E Sbjct: 237 VLVLGAICRAHGFSVIKLIRY-------------IREELLIVLGTSSSESALPRMLIKME 283 Query: 378 EKNGVAKHISRFILPIGATVNMDGAALFQCVAAVFIAQLNGVSLDFVKIITILVTATASS 437 + G K + ++P G + N+DG +++ +AAVFIAQ +D IT+L+ SS Sbjct: 284 -RLGAQKSVVGLVIPTGYSFNLDGTSIYLTMAAVFIAQATDTPMDLTAQITLLLVLLLSS 342 Query: 438 VGAAGIPAGGVLTLAIILEAV-SLPVKDISLILAVDWLVDRSCTVLNVEGDAFGAGLLQS 496 GAAG+ G + LA L AV SLPV ++LIL +D + + + N+ G+A ++ Sbjct: 343 KGAAGVTGSGFIVLAATLSAVGSLPVAGLALILGIDRFMSEARALTNLVGNAVATLVVAK 402 Query: 497 YVDRTKMPSSEPEL 510 +V + + EL Sbjct: 403 WVKELDEDTLQVEL 416 Lambda K H 0.323 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 435 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 553 Length of database: 444 Length adjustment: 34 Effective length of query: 519 Effective length of database: 410 Effective search space: 212790 Effective search space used: 212790 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory