Align Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein; LIVAT-BP; Leu/Ile/Val/Thr/Ala-binding protein (characterized)
to candidate Pf1N1B4_1382 Branched-chain amino acid ABC transporter, amino acid-binding protein (TC 3.A.1.4.1)
Query= SwissProt::P21175 (373 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1382 Length = 377 Score = 279 bits (714), Expect = 8e-80 Identities = 150/359 (41%), Positives = 212/359 (59%), Gaps = 5/359 (1%) Query: 12 FAAMAIAGFASYSMAADT-IKIALAGPVTGPVAQYGDMQRAGALMAIEQINKAGGVNGAQ 70 F A+A+A S A IKI +AGP+TG A +G+ GA A + +N AGGVNG + Sbjct: 10 FLALAVATALGVSAFAQADIKIGVAGPMTGANAAFGEQYMKGAQAAADAVNAAGGVNGEK 69 Query: 71 LEGVIYDDACDPKQAVAVANKVVNDGVKFVVGHVCSSSTQPATDIYEDEGVLMITPSATA 130 + V DDAC+PKQAV VA + N V VVGH CSSST PA++IY++ G++ ITP +T Sbjct: 70 IVLVKGDDACEPKQAVTVAKDLTNQKVAGVVGHFCSSSTIPASEIYDEAGIIAITPGSTN 129 Query: 131 PEITSRGYKLIFRTIGLDNMQGPVAGKFIAERYKDKTIAVLHDKQQYGEGIATEVKKTVE 190 P +T RG +FR G D+ QG VAG +I + K K + VLHDK YG+G+A K + Sbjct: 130 PAVTERGLSAMFRMCGRDDQQGIVAGDYIVDVLKGKKVVVLHDKDTYGQGLADATKAQLA 189 Query: 191 DAGIKVAVFEGLNAGDKDFNALISKLKKAGVQFVYFGGYHPEMGLLLRQAKQAGL-DARF 249 G+ ++EGL G+KDF+ +++K++ AG VYFGG HPE G L+RQ ++ GL D +F Sbjct: 190 KRGVTPVLYEGLTRGEKDFSTIVTKIRGAGADVVYFGGLHPEAGPLVRQLREQGLKDVKF 249 Query: 250 MGPEGVGNSEITAIAGDAS--EGMLATLPRAFEQDPKNKALIDAFKAKNQDPSGIFVLPA 307 M +G+ E+ AG +G+L T P +K ++D F+ K +P G + L A Sbjct: 250 MSDDGIVTDELVTTAGGPQFVDGVLMTFGADPRLLPDSKTVVDDFRKKGTEPEG-YTLYA 308 Query: 308 YSAVTVIAKGIEKAGEADPEKVAEALRANTFETPTGNLGFDEKGDLKNFDFTVYEWHKD 366 Y++V +A A E+ A L+ N +T G +D KGDLK D+ VY+W KD Sbjct: 309 YASVQTLAAAFNGAKSNKGEEAAAWLKKNPVKTVMGEKTWDSKGDLKISDYVVYQWDKD 367 Lambda K H 0.316 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 402 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 377 Length adjustment: 30 Effective length of query: 343 Effective length of database: 347 Effective search space: 119021 Effective search space used: 119021 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory