GapMind for catabolism of small carbon sources

 

Aligments for a candidate for cycA in Pseudomonas fluorescens FW300-N1B4

Align L-alanine and D-alanine permease (characterized)
to candidate Pf1N1B4_1580 Histidine transport protein (permease)

Query= reanno::pseudo5_N2C3_1:AO356_17670
         (473 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1580 Histidine transport
           protein (permease)
          Length = 469

 Score =  516 bits (1330), Expect = e-151
 Identities = 244/455 (53%), Positives = 329/455 (72%), Gaps = 2/455 (0%)

Query: 18  LKRELGERHIRLMALGACIGVGLFLGSAKAIEMAGPAIMLSYIIGGLAILVIMRALGEMA 77
           LKR L  RHIR MALG+ IG GLF GSA AI+MAGPA++L+Y+IGG A+ ++MRALGEMA
Sbjct: 8   LKRGLSARHIRFMALGSAIGTGLFYGSASAIQMAGPAVLLAYLIGGAAVFMVMRALGEMA 67

Query: 78  VHNPVAGSFSRYAQDYLGPLAGFLTGWNYWFLWLVTCVAEITAVAVYMGIWFPDVPRWIW 137
           VHNPVAGSF +YA  YLGP+AGF+ GW Y F  ++  +A++TA  +YMG WFP+V RWIW
Sbjct: 68  VHNPVAGSFGQYASTYLGPMAGFILGWTYAFEMVIVGMADVTAFGIYMGFWFPEVDRWIW 127

Query: 138 ALAALVSMGSINLIAVKAFGEFEFWFALIKIVTIIAMVIGGVGIIAFGFGN--DGVALGI 195
            L  +  +G +NL  VK FGE EFW +L+K+  I+AM++GG GI+ FG        A  I
Sbjct: 128 VLGIVSVVGGLNLCNVKVFGEMEFWLSLLKVAAIVAMILGGFGIMLFGISTAPGAQATDI 187

Query: 196 SNLWAHGGFMPNGVSGVLMSLQMVMFAYLGVEMIGLTAGEAKNPQKTIPNAIGSVFWRIL 255
           SNLW+HGGFMPNGV G++ S  +VMFA+ G+E+IG+TAGEAK+PQ+ +P AI +V  RIL
Sbjct: 188 SNLWSHGGFMPNGVGGLIASFAVVMFAFGGIEIIGVTAGEAKDPQRVLPRAINAVPLRIL 247

Query: 256 LFYVGALFVILSIYPWNEIGTQGSPFVMTFERLGIKTAAGIINFVVITAALSSCNGGIFS 315
           LFYV  + V++SI+PW +IG+QGSPFV  F+ LGI +AA I+N VVI+AA+S+ N  IF 
Sbjct: 248 LFYVLTMLVLMSIFPWQQIGSQGSPFVQIFDNLGISSAATILNIVVISAAVSAINSDIFG 307

Query: 316 TGRMLYSLAQNGQAPAGFAKTSTNGVPRRALLLSIAALLLGVLLNYLVPEKVFVWVTSIA 375
            GRM+Y LAQ G AP GFA+ S NGVP   +++  +ALLLGVLLNYL+PE VF+ + S+A
Sbjct: 308 AGRMMYGLAQQGHAPKGFARLSRNGVPWLTVVVMSSALLLGVLLNYLIPENVFLLIASVA 367

Query: 376 TFGAIWTWVMILLAQLKFRKSLSASERAALKYRMWLYPVSSYLALAFLVLVVGLMAYFPD 435
           TF  +W W+MIL  Q+  R+S+SA + A LK+ +  +P +   A+AF++ + G++ YFPD
Sbjct: 368 TFATVWVWLMILFTQVAMRRSMSAEQVAQLKFPVPFWPYAPMAAIAFMLFIFGVLGYFPD 427

Query: 436 TRVALYVGPAFLVLLTVLFYTFKLQPTGDVQRAVR 470
           T+ AL VG  ++VLL + + T+     G      R
Sbjct: 428 TQAALIVGVVWIVLLVLAYLTWVKPAAGQAALVAR 462


Lambda     K      H
   0.328    0.142    0.444 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 716
Number of extensions: 35
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 473
Length of database: 469
Length adjustment: 33
Effective length of query: 440
Effective length of database: 436
Effective search space:   191840
Effective search space used:   191840
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory