Align Periplasmic binding protein/LacI transcriptional regulator (characterized, see rationale)
to candidate Pf1N1B4_4285 Inositol transport system sugar-binding protein
Query= uniprot:A0KWY4 (313 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4285 Length = 308 Score = 135 bits (340), Expect = 1e-36 Identities = 96/283 (33%), Positives = 148/283 (52%), Gaps = 11/283 (3%) Query: 9 ALGLWAVSATCAYATTVGFSQVGSESGWRTSFSEAVKAEAKQR--GIDLKFADAQQKQEN 66 AL L S +G S + W T E++ +AK G+ L+F DA+ Sbjct: 11 ALSLMFASGAALADMKIGVSMSQFDDTWLTYLRESMDTKAKSYPDGVKLQFEDARSDVVR 70 Query: 67 QIKAVRSFIAQGVDAIIIAPVVETGWKPVLKEAKRAKIPVVIVDRNIKVDDDSL--FLTR 124 Q+ V SFI+Q VDAI++ PV K + + A +A IP+V V+R + DD +L + Sbjct: 71 QLSQVESFISQKVDAIVVNPVDTAATKKITEAAVKAGIPLVYVNR--RPDDLNLPKGVVT 128 Query: 125 IASDFSEEGRKIGQWLMDKTQGNCDIAELQGTVGATAAIDRAAGFNQVIANYPNAKIVRS 184 +AS+ E G+ Q+L +K G DI L G + + +R G +V+ YPN KI + Sbjct: 129 VASNDLEAGQMQMQYLAEKMGGKGDIVILLGDLANNSTTNRTKGVKEVLTKYPNIKIEQE 188 Query: 185 QTGEFTRAKGKEVMEGFLKAQNGQPLCAVWSHNDEMALGAVQAIKEAGLKPGKDILIVSV 244 Q+G ++R KG ++ +L G+ AV S+NDEMA+GA A+++AG+ G +LI V Sbjct: 189 QSGIWSRDKGMTLVNDWL--TQGRKFDAVVSNNDEMAIGAAMALQQAGVAKG-SVLIAGV 245 Query: 245 DGVPDYFKAMADGDVNATVELSPYLGGPAFDAIDAYLKGNKDQ 287 DG PD A+ G + V + G A +ID +K K++ Sbjct: 246 DGTPDGLNAVKKGSL--LVSVFQDAKGQADGSIDTAVKMAKNE 286 Lambda K H 0.316 0.131 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 222 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 308 Length adjustment: 27 Effective length of query: 286 Effective length of database: 281 Effective search space: 80366 Effective search space used: 80366 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory