Align Inner-membrane translocator (characterized, see rationale)
to candidate Pf1N1B4_4287 Inositol transport system permease protein
Query= uniprot:A0KWY6 (405 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4287 Length = 340 Score = 162 bits (409), Expect = 2e-44 Identities = 100/279 (35%), Positives = 156/279 (55%), Gaps = 17/279 (6%) Query: 107 VALLSIGMSLVIATGGIDLSVGAVMAIAGAVCANLLLVPDISLVTV-----------IAA 155 + LL+IG++ VI T GIDLS G+V+A++ + A+L D + + Sbjct: 66 IGLLAIGVTQVIITTGIDLSSGSVLALSAMIAASLAQTSDFARAVFPSLTDLPVWIPVIV 125 Query: 156 GLIVGLLAGCINGGLVSFLGIQPIVATLLLMVAGRGVAQLINQGQIITFQHPGFAAIGVG 215 GL VGLLAG ING +++ GI P +ATL +MV+ RG+A+ +GQ ++ + AIG G Sbjct: 126 GLGVGLLAGAINGSIIAITGIPPFIATLGMMVSARGLARYYTEGQPVSMLSDSYTAIGHG 185 Query: 216 QFLGLPMPVWIVIGMLTFSQLLLRKTALGLFIEAVGCNAKASRYLGINDKSIKLFAYGIA 275 MPV I + + + LR T G + A+G N +A+R GIN K + Y IA Sbjct: 186 -----AMPVIIFLVVAVIFHIALRYTKYGKYTYAIGGNMQAARTSGINVKRHLVIVYSIA 240 Query: 276 GLCAALAGMISTADIQGSDANNAGLWLELDAVLAVVIGGAALTGGRFSLILSVVGALIIQ 335 GL A LAG++++A A G+ ELDA+ A VIGG +L GG + +V+GALI+ Sbjct: 241 GLLAGLAGVVASARAATGQA-GMGMSYELDAIAAAVIGGTSLAGGVGRITGTVIGALILG 299 Query: 336 TLATTIIVSGLPAKFNLLIKAIVILTVLLLQSAKFRRQL 374 +A+ G+ A +IK ++I+ +++ + +R+L Sbjct: 300 VMASGFTFVGVDAYIQDIIKGLIIVVAVVIDQYRNKRKL 338 Lambda K H 0.323 0.136 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 340 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 340 Length adjustment: 30 Effective length of query: 375 Effective length of database: 310 Effective search space: 116250 Effective search space used: 116250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory