GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gguA in Pseudomonas fluorescens FW300-N1B4

Align GguA aka ATU2347 aka AGR_C_4264, component of Multiple sugar (arabinose, xylose, galactose, glucose, fucose) putative porter (characterized)
to candidate Pf1N1B4_410 L-arabinose transport ATP-binding protein AraG (TC 3.A.1.2.2)

Query= TCDB::O05176
         (512 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_410 L-arabinose transport
           ATP-binding protein AraG (TC 3.A.1.2.2)
          Length = 514

 Score =  308 bits (790), Expect = 2e-88
 Identities = 178/498 (35%), Positives = 293/498 (58%), Gaps = 13/498 (2%)

Query: 6   LEMRNITKTFPGVKALENVNLKVKEGEIHALVGENGAGKSTLMKVLSGVYPAGTYEGEIH 65
           L    I KTFPGVKAL+ ++     G++HAL+GENGAGKSTL+K+L G Y   +  G++ 
Sbjct: 16  LRFNGIGKTFPGVKALDGISFVAHPGQVHALMGENGAGKSTLLKILGGAYTPSS--GDLQ 73

Query: 66  YEGAVRNFRAINDSEDIGIIIIHQELALVPLLSIAENIFLGNEVASNGVISWQQTFNRTR 125
                R F++  DS   G+ +IHQEL LVP +++AEN+FLG+  AS G+I+      +  
Sbjct: 74  IGEQKRIFKSTADSIGSGVAVIHQELHLVPEMTVAENLFLGHLPASFGLINRGVLRQQAL 133

Query: 126 ELLKKVGLKESPETLITDIGVGKQQLVEIAKALSKSVKLLILDEPTASLNESDSEALLNL 185
             LK +  +  P+  +  + +G++QLVEIAKALS+   ++  DEPT+SL+  + + L+ +
Sbjct: 134 ACLKGLADEIDPQEKVGRLSLGQRQLVEIAKALSRGAHVIAFDEPTSSLSAREIDRLMAI 193

Query: 186 LMEFRNQGMTSIIITHKLNEVRKVADQITVLRDGMTVKTLDCHQEEISEDVIIRNMVGRD 245
           +   R++G   + ++H++ EV ++ + +TV +DG  V+T +     ++ D ++  MVGRD
Sbjct: 194 IGRLRDEGKVVLYVSHRMEEVFRICNAVTVFKDGRFVRTFE-DMSALTHDQLVTCMVGRD 252

Query: 246 LEDRYPPRDVPIGETILEVKNWNAYHQQHRDRQVLHDINVTVRKGEVVGIAGLMGAGRTE 305
           ++D Y  R  P G   L+V              +   ++    KGE++G+ GL+GAGRTE
Sbjct: 253 IQDIYDYRSRPRGAVALKVDGL-------LGPGLREPVSFEAHKGEILGLFGLVGAGRTE 305

Query: 306 FAMSVFGKSYGHRITGDVLIDGKPVDVSTVRKAIDAGLAYVTEDRKHLGLVLNDNILHNT 365
               + G +      G + + G+ + + + R AI AG+    EDRK  G++   ++  N 
Sbjct: 306 LFRMLSGLT--RNTAGRLELRGRELKLHSPRDAIAAGILLCPEDRKKEGILPLASVAENI 363

Query: 366 TL-ANLAGVSKASIIDDIKEMKVASDFRTRLRIRSSGIFQETVNLSGGNQQKVVLSKWLF 424
            + A  A  +   ++  + E   A      L++++    Q+ + LSGGNQQK +L +WL 
Sbjct: 364 NISARGAHSTFGCLLRGLWEKDNADKQIKALKVKTPNAAQKIMYLSGGNQQKAILGRWLS 423

Query: 425 SNPDVLILDEPTRGIDVGAKYEIYTIINQLAADGKGVLMISSEMPELLGNCDRIYVMNEG 484
               VL+LDEPTRGID+GAK EIY II+ LAA G  V+++SS++ E++G  DRI V+ EG
Sbjct: 424 MPMKVLLLDEPTRGIDIGAKAEIYQIIHNLAASGIAVIVVSSDLMEVMGISDRILVLCEG 483

Query: 485 RIVAELPKGEASQESIMR 502
            +  EL + +A++ ++++
Sbjct: 484 AMRGELTREQANESNLLQ 501


Lambda     K      H
   0.316    0.135    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 590
Number of extensions: 29
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 512
Length of database: 514
Length adjustment: 35
Effective length of query: 477
Effective length of database: 479
Effective search space:   228483
Effective search space used:   228483
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory