GapMind for catabolism of small carbon sources

 

Aligments for a candidate for adiA in Pseudomonas fluorescens FW300-N1B4

Align Biosynthetic arginine decarboxylase (EC 4.1.1.19) (characterized)
to candidate Pf1N1B4_1296 Biosynthetic arginine decarboxylase (EC 4.1.1.19)

Query= reanno::pseudo1_N1B4:Pf1N1B4_1296
         (637 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1296 Biosynthetic arginine
           decarboxylase (EC 4.1.1.19)
          Length = 637

 Score = 1271 bits (3289), Expect = 0.0
 Identities = 637/637 (100%), Positives = 637/637 (100%)

Query: 1   MSVRRTRKDDGSQWTVADSRSVYGIRHWGAGYFAINDAGRVEVRPNGPTSSPIDLFEQVD 60
           MSVRRTRKDDGSQWTVADSRSVYGIRHWGAGYFAINDAGRVEVRPNGPTSSPIDLFEQVD
Sbjct: 1   MSVRRTRKDDGSQWTVADSRSVYGIRHWGAGYFAINDAGRVEVRPNGPTSSPIDLFEQVD 60

Query: 61  QLRKSGLSLPLLVRFPDILQDRVRQLTGAFDANIERLEYQSKYTALYPIKVNQQEAVIEN 120
           QLRKSGLSLPLLVRFPDILQDRVRQLTGAFDANIERLEYQSKYTALYPIKVNQQEAVIEN
Sbjct: 61  QLRKSGLSLPLLVRFPDILQDRVRQLTGAFDANIERLEYQSKYTALYPIKVNQQEAVIEN 120

Query: 121 IIATQNVSIGLEAGSKPELLAVLALAPKGGTIVCNGYKDREFIRLALMGQKLGHNVFIVI 180
           IIATQNVSIGLEAGSKPELLAVLALAPKGGTIVCNGYKDREFIRLALMGQKLGHNVFIVI
Sbjct: 121 IIATQNVSIGLEAGSKPELLAVLALAPKGGTIVCNGYKDREFIRLALMGQKLGHNVFIVI 180

Query: 181 EKESEVGLVIEEAASLKVKPQVGLRVRLSSLASSKWADTGGEKSKFGLSAAQLLSVVERF 240
           EKESEVGLVIEEAASLKVKPQVGLRVRLSSLASSKWADTGGEKSKFGLSAAQLLSVVERF
Sbjct: 181 EKESEVGLVIEEAASLKVKPQVGLRVRLSSLASSKWADTGGEKSKFGLSAAQLLSVVERF 240

Query: 241 RAAGLDQGIRLLHFHMGSQIANLADYQHGFKEAIRYYGELRNLGLPVDHIDVGGGLGVDY 300
           RAAGLDQGIRLLHFHMGSQIANLADYQHGFKEAIRYYGELRNLGLPVDHIDVGGGLGVDY
Sbjct: 241 RAAGLDQGIRLLHFHMGSQIANLADYQHGFKEAIRYYGELRNLGLPVDHIDVGGGLGVDY 300

Query: 301 DGTHSRNASSINYDMDDYAGVVVGMLKEFCDAQSLPHPNIFSESGRSLTAHHAMLVVQVT 360
           DGTHSRNASSINYDMDDYAGVVVGMLKEFCDAQSLPHPNIFSESGRSLTAHHAMLVVQVT
Sbjct: 301 DGTHSRNASSINYDMDDYAGVVVGMLKEFCDAQSLPHPNIFSESGRSLTAHHAMLVVQVT 360

Query: 361 DVEKHNDDVPKIDNKEELPETVQWLVDLLGPTDIEMVTETYWRATHYMSDVATQYADGKL 420
           DVEKHNDDVPKIDNKEELPETVQWLVDLLGPTDIEMVTETYWRATHYMSDVATQYADGKL
Sbjct: 361 DVEKHNDDVPKIDNKEELPETVQWLVDLLGPTDIEMVTETYWRATHYMSDVATQYADGKL 420

Query: 421 TLAQKALAEQCYFAVCRRLHNSLKARQRSHRQVLDELNDKLADKYICNFSVFQSLPDTWA 480
           TLAQKALAEQCYFAVCRRLHNSLKARQRSHRQVLDELNDKLADKYICNFSVFQSLPDTWA
Sbjct: 421 TLAQKALAEQCYFAVCRRLHNSLKARQRSHRQVLDELNDKLADKYICNFSVFQSLPDTWA 480

Query: 481 IGQVLPILPLHRLDEEPLRRAVLQDLTCDSDGKIKQYVDEQSIETSLPVHGLNEGEDYLL 540
           IGQVLPILPLHRLDEEPLRRAVLQDLTCDSDGKIKQYVDEQSIETSLPVHGLNEGEDYLL
Sbjct: 481 IGQVLPILPLHRLDEEPLRRAVLQDLTCDSDGKIKQYVDEQSIETSLPVHGLNEGEDYLL 540

Query: 541 GIFLVGAYQEILGDMHNLFGDTDSVNIYQNADGSVYHAGIETHDTIEDMLRYVHLSPEEL 600
           GIFLVGAYQEILGDMHNLFGDTDSVNIYQNADGSVYHAGIETHDTIEDMLRYVHLSPEEL
Sbjct: 541 GIFLVGAYQEILGDMHNLFGDTDSVNIYQNADGSVYHAGIETHDTIEDMLRYVHLSPEEL 600

Query: 601 MTHYRDKCASARISAAERTQFLDALRLGLTRSSYLSS 637
           MTHYRDKCASARISAAERTQFLDALRLGLTRSSYLSS
Sbjct: 601 MTHYRDKCASARISAAERTQFLDALRLGLTRSSYLSS 637


Lambda     K      H
   0.319    0.136    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1417
Number of extensions: 44
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 637
Length of database: 637
Length adjustment: 38
Effective length of query: 599
Effective length of database: 599
Effective search space:   358801
Effective search space used:   358801
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

Align candidate Pf1N1B4_1296 (Biosynthetic arginine decarboxylase (EC 4.1.1.19))
to HMM TIGR01273 (speA: arginine decarboxylase (EC 4.1.1.19))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01273.hmm
# target sequence database:        /tmp/gapView.17988.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01273  [M=624]
Accession:   TIGR01273
Description: speA: arginine decarboxylase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                      -----------
   6.1e-273  892.9   0.0   6.9e-273  892.7   0.0    1.0  1  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1296  Biosynthetic arginine decarboxyl


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1296  Biosynthetic arginine decarboxylase (EC 4.1.1.19)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  892.7   0.0  6.9e-273  6.9e-273       1     624 []      14     636 ..      14     636 .. 0.99

  Alignments for each domain:
  == domain 1  score: 892.7 bits;  conditional E-value: 6.9e-273
                                      TIGR01273   1 wsaeesakvYnikgWgagyfavnkeGevsvrpkgeetlkeidllelvkqveakglklPllvrFp 64 
                                                    w++++s++vY+i++Wgagyfa+n++G+v+vrp+g + ++ idl e v+q+++ gl+lPllvrFp
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1296  14 WTVADSRSVYGIRHWGAGYFAINDAGRVEVRPNGPT-SSPIDLFEQVDQLRKSGLSLPLLVRFP 76 
                                                    88999***************************9887.99************************* PP

                                      TIGR01273  65 dilqkrikslnaaFkeaieeleYaskyqavyPiKvnqqrevveelvasggkslGLEaGsKpEll 128
                                                    dilq+r+++l+ aF+++ie+leY+sky+a+yPiKvnqq++v+e+++a+++ s+GLEaGsKpEll
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1296  77 DILQDRVRQLTGAFDANIERLEYQSKYTALYPIKVNQQEAVIENIIATQNVSIGLEAGSKPELL 140
                                                    **************************************************************** PP

                                      TIGR01273 129 ialalaekpkavivcnGyKDreyielaliarklglkvviviekleEldlvieeakklgvkPklG 192
                                                    ++lala  ++ +ivcnGyKDre+i+lal+++klg++v+iviek++E+ lvieea++l+vkP++G
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1296 141 AVLALAP-KGGTIVCNGYKDREFIRLALMGQKLGHNVFIVIEKESEVGLVIEEAASLKVKPQVG 203
                                                    *******.8899**************************************************** PP

                                      TIGR01273 193 lRvrLaskgsgkwassgGeksKFGLsasqvlevvkklkeedlldslkllHfHlGsqianiddvk 256
                                                    lRvrL+s +s+kwa++gGeksKFGLsa+q+l+vv+++++++l++ ++llHfH+Gsqian++d++
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1296 204 LRVRLSSLASSKWADTGGEKSKFGLSAAQLLSVVERFRAAGLDQGIRLLHFHMGSQIANLADYQ 267
                                                    **************************************************************** PP

                                      TIGR01273 257 kgvrEaarlyvelrklGvkievvdvGGGLgvdYdGtksksdlsvnYsleeyaaavvaalkevce 320
                                                    +g++Ea+r+y elr+lG++++++dvGGGLgvdYdGt+s++++s+nY++++ya  vv +lke+c+
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1296 268 HGFKEAIRYYGELRNLGLPVDHIDVGGGLGVDYDGTHSRNASSINYDMDDYAGVVVGMLKEFCD 331
                                                    **************************************************************** PP

                                      TIGR01273 321 ekgvpePviisEsGRaitahhavlvaevleveeeeeeeaeeile.eeapeevkeleellkeide 383
                                                    ++++p+P+i+sEsGR++tahha+lv++v++ve+++++ +++i + ee pe+v++l +ll+++d 
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1296 332 AQSLPHPNIFSESGRSLTAHHAMLVVQVTDVEKHNDD-VPKIDNkEELPETVQWLVDLLGPTDI 394
                                                    ***********************************99.666555589***************** PP

                                      TIGR01273 384 esaeelledavqlleeavelfklGkldleeralaeqlalailkkvke.leakekshreildelq 446
                                                    e+++e++++a+++++++++++++Gkl+l+++alaeq++ a+++++++ l+a+++shr++ldel+
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1296 395 EMVTETYWRATHYMSDVATQYADGKLTLAQKALAEQCYFAVCRRLHNsLKARQRSHRQVLDELN 458
                                                    **************************************************************** PP

                                      TIGR01273 447 eklaekylvnlslFqslPDaWgidqlfPilPlerLdekpdrravllDltCDsDGkikkfveeqg 510
                                                    +kla+ky++n+s+FqslPD+W+i+q++PilPl+rLde+p rravl+DltCDsDGkik++v+eq+
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1296 459 DKLADKYICNFSVFQSLPDTWAIGQVLPILPLHRLDEEPLRRAVLQDLTCDSDGKIKQYVDEQS 522
                                                    **************************************************************** PP

                                      TIGR01273 511 iektlplheldkdeeyllgfflvGAYqEiLgdvHnLFgdteavevvvkekgeveveaieegdtv 574
                                                    ie++lp+h l++ e+yllg+flvGAYqEiLgd+HnLFgdt++v+++++++g+v+++ ie++dt+
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1296 523 IETSLPVHGLNEGEDYLLGIFLVGAYQEILGDMHNLFGDTDSVNIYQNADGSVYHAGIETHDTI 586
                                                    **************************************************************** PP

                                      TIGR01273 575 edvlkavqydpeellkalkqkvaeaklkaeekkqvlelleaglsgypYLs 624
                                                    ed+l++v+++peel++++++k a+a+++a+e++q+l++l+ gl++++YLs
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1296 587 EDMLRYVHLSPEELMTHYRDKCASARISAAERTQFLDALRLGLTRSSYLS 636
                                                    ************************************************96 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (624 nodes)
Target sequences:                          1  (637 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.04u 0.02s 00:00:00.06 Elapsed: 00:00:00.05
# Mc/sec: 7.72
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory