GapMind for catabolism of small carbon sources

 

Aligments for a candidate for adiA in Pseudomonas fluorescens FW300-N1B4

Align arginine decarboxylase (EC 4.1.1.19) (characterized)
to candidate Pf1N1B4_4600 Lysine decarboxylase, inducible (EC 4.1.1.18)

Query= BRENDA::E8X9U7
         (756 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4600 Lysine decarboxylase,
           inducible (EC 4.1.1.18)
          Length = 751

 Score =  569 bits (1467), Expect = e-166
 Identities = 306/765 (40%), Positives = 449/765 (58%), Gaps = 36/765 (4%)

Query: 4   VLIVESEFLHQDTWVGNAVERLADALSQQNVTVIKSTSFDDGYAILSANEAIDCLMFSYQ 63
           VLIV  + +  DT  G+ V  +A  L Q+  +++ +  +++G  + S +  + C++ + +
Sbjct: 9   VLIVHRD-IKADTVAGDRVRGIARELEQEGFSIVSAVDYNEGRLVASTHHGLSCMLIAAE 67

Query: 64  MEQPDEHL--SVRQLIGKLHERQQNVPVFLLGDR---EKATASLDRDLLELVDEFAWILE 118
                 HL  ++ +LI     R  ++P+F LG++   E A A    +L +L     ++ E
Sbjct: 68  DASTHAHLLHNMAELIRLARVRAPDLPIFALGEQVTLENAPADAMAELNQLRG-ILYLFE 126

Query: 119 DTADFIAGRAVAAMTRYRQQLLPPLFNALMKYSDIHEYSWAAPGHQGGVGFTKTPAGRFY 178
           DT  F+A +   A  +Y   LLPP F AL++++    YSW  PGH GGV + K+P G+ +
Sbjct: 127 DTVPFLARQVARAARKYLDGLLPPFFKALVQHTADSNYSWHTPGHGGGVAYHKSPVGQAF 186

Query: 179 HDYYGENLFRSDMGIERTTLGSLLDHTGAFGESEKNAARVFGADRSWSVVVGTSGSNRTI 238
           H ++GEN  RSD+ +    LGSLLDHTG   E+E  AAR FGAD ++ V+ GTS +N+ +
Sbjct: 187 HQFFGENTLRSDLSVSVPELGSLLDHTGPLAEAEARAARNFGADHTFFVINGTSTANKIV 246

Query: 239 MQACMTDNDVVVLDRNCHKSIEQGLILTGAKPVYMVPSRNRYGIIGPIYPQEMQPETLQK 298
             + +  +D+V++DRNCHKS+   +I+TGA P+Y+ P RN  GIIGPI   E   E++Q 
Sbjct: 247 WHSMVARDDLVLVDRNCHKSVLHSIIMTGAIPLYLCPERNELGIIGPIPLSEFSRESIQA 306

Query: 299 KISASPLTKTKAGQKPSYSVVTNCTYDGVCYNAKEAQDLLAKTSDRIHFDEAWYGYARFN 358
           KI ASPLTK +   K   +VVTN TYDG+CYNA+  +  L  + + +HFDEAWY YA F+
Sbjct: 307 KIDASPLTKGRE-PKVKLAVVTNSTYDGLCYNAELIKQSLGNSVEVLHFDEAWYAYAAFH 365

Query: 359 PIYCDHYAMRGEPGDHNGPTVFATHSTHKLLNALSQASYIHVREGRGA-VNFSRFNQAYM 417
             +   Y M G     + P VF THSTHKLL A SQAS IHV++G    ++  RFN+A+M
Sbjct: 366 EFFAGRYGM-GTSRSEDSPLVFTTHSTHKLLAAFSQASMIHVQDGGARQLDRDRFNEAFM 424

Query: 418 MHATTSPLYAICASNDVAVSMMDGNSGLSLTQEVIDEAVDFRQAMARLYKEFTDEGDWFF 477
           MH +TSP Y+I AS DVA +MM+G +G SL QE+ DEA+ FR+A+A L +    + DW+F
Sbjct: 425 MHISTSPQYSIIASLDVASAMMEGPAGRSLLQEMFDEALSFRRALANLRQHIAAD-DWWF 483

Query: 478 KPWNKDVVTDPQTGKTYDFADAPAKLLATDQNCWVMRPGETWHGFKDLPDNWSMLDPIKV 537
             W        +   T D               W+++P   WHGF  + D++ +LDPIKV
Sbjct: 484 SIWQPPSAEGIEQVVTED---------------WLLQPDADWHGFGGVTDDYVLLDPIKV 528

Query: 538 SILAPGMGDDGELEASGVPAALVTAWLGRHGIVPTRTTDFQIMFLFSMGVTRGKWGTLIN 597
           +++ PG+   G L A G+PAA+V+ +L   G+V  +T  +  + LFSMG+T+GKW TL+ 
Sbjct: 529 TLVMPGLTAGGALSARGIPAAVVSKFLWERGLVVEKTGLYSFLVLFSMGITKGKWSTLLT 588

Query: 598 TLCSFKHHYDANTPLAQVMPELVQDYPDTYANMGIHDLGDKMFAWLRENNPGARLNAAYS 657
            L  FK  YDAN  LA  +P + Q     Y  MG+ DL D++ A  R N     L   Y+
Sbjct: 589 ELLEFKRSYDANVSLATCLPCVAQHNVARYQGMGLRDLCDQLHACYRSNATAKHLKRMYT 648

Query: 658 TLPVAEITPRDAYNAIVNNNIEMVAIENLPGRIAANSVIPYPPGIPMLLSGENFGDENSP 717
            LP   + P DAY+ +V   +E V+I+ L GRIAA  ++PYPPGIP+++ GE F +    
Sbjct: 649 VLPEVAMKPADAYDQLVRGEVEAVSIDALDGRIAAVMLVPYPPGIPLIMPGERFTESTRS 708

Query: 718 QVGYLRSLQSWDHHFPGF-------EHETEGTEIIDGVYHVMCVK 755
            + YL+  +++D  FPGF       +HE EG       Y V C+K
Sbjct: 709 IIDYLKFARTFDSSFPGFVADVHGLQHEDEGN---GRHYTVDCIK 750


Lambda     K      H
   0.319    0.135    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1375
Number of extensions: 65
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 756
Length of database: 751
Length adjustment: 40
Effective length of query: 716
Effective length of database: 711
Effective search space:   509076
Effective search space used:   509076
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory